SVM-Fold Query Results

Fold	Score	Confidence	Class	Description	Fold	Description	Comments
a.1	2.7577	1.0000	a	All alpha proteins	a.1	Globin-like	core: 6 helices; folded leaf, partly opened
a.34	-2.5018	0.4000	a	All alpha proteins	a.34	Dimerisation interlock	4 helices; bundle, closed, right-handed twist
a.159	-2.6419	0.0012	a	All alpha proteins	a.159	Another 3-helical bundle	topologically similar to the DNA/RNA-binding bundles; distinct packing
d.95	-2.6450	0.0028	d	Alpha and beta proteins (a+b)	d.95	Homing endonuclease-like	alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
d.75	-2.6508	0.0010	d	Alpha and beta proteins (a+b)	d.75	MutS N-terminal domain-like	beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
g.16	-2.6583	0.0010	g	Small proteins	g.16	Trefoil/Plexin domain-like	disulfide-rich fold; common core is alpha+beta with two conserved disulfides
c.44	-2.6606	0.0013	c	Alpha and beta proteins (a/b)	c.44	Phosphotyrosine protein phosphatases I-like	3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
d.82	-2.6611	0.0007	d	Alpha and beta proteins (a+b)	d.82	N domain of copper amine oxidase-like	alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
a.23	-2.6611	0.0023	a	All alpha proteins	a.23	Open three-helical up-and-down bundle	core: 3 helices; bundle, open
b.77	-2.6625	0.0017	b	All beta proteins	b.77	beta-Prism I	consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis ! duplication: has internal pseudo threefold symmetry
g.2	-2.6649	0.0005	g	Small proteins	g.2	Toxic hairpin	disulfide crosslinked alpha-helical hairpin
d.170	-2.6663	0.0005	d	Alpha and beta proteins (a+b)	d.170	SRCR-like	unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta
d.13	-2.6667	0.0018	d	Alpha and beta proteins (a+b)	d.13	HIT-like	alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
c.9	-2.6672	0.0003	c	Alpha and beta proteins (a/b)	c.9	Barstar-like	2 layers, a/b; parallel beta-sheet of 3 strands, order 123
d.87	-2.6676	0.0086	d	Alpha and beta proteins (a+b)	d.87	CO dehydrogenase flavoprotein C-domain-like	core: beta(3,4)-alpha(3); alpha+beta sandwich
a.48	-2.6682	0.0005	a	All alpha proteins	a.48	N-cbl like	4 helices; bundle, left-handed twist; left-handed superhelix
a.71	-2.6695	0.0007	a	All alpha proteins	a.71	ERP29 C domain-like	5 helices; bundle
c.98	-2.6727	0.0011	c	Alpha and beta proteins (a/b)	c.98	MurF and HprK N-domain-like	core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1234; structural similarity of the MurF and HprK extends beyond the core.
d.83	-2.6737	0.0005	d	Alpha and beta proteins (a+b)	d.83	Aha1/BPI domain-like	core: [beta]-alpha-beta(5)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, meander
a.46	-2.6739	0.0012	a	All alpha proteins	a.46	Methionine synthase domain-like	4 helices; bundle, left-handed twist; right-handed superhelix

Make log for job:92
src/blast/blast-2.2.13/bin/blastpgp -d data/nrdb/nr.blast-2.2.13 -b 0 -j 5 -i input.fasta -Q profile.pssm -C profile.chk
BLASTP 2.2.13 [Nov-27-2005]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravaind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,
Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005.

Query=
(116 letters)

Database: nr.blast-2.2.13
3,044,223 sequences; 1,047,289,308 total letters

Searching..................................................done

Results from round 1

Score E
Sequences producing significant alignments: (bits) Value

gi|7322057|gb|AAA29446.2| hemoglobin major component [Paramecium... 180 1e-44
gi|415308|dbj|BAA02300.1| B-type of major hemoglobin component [... 180 2e-44
gi|47169309|pdb|1UVY|A Chain A, Heme-Ligand Tunneling In Group I... 179 3e-44
gi|12248875|dbj|BAB20310.1| hemoglobin [Paramecium caudatum] >gn... 172 4e-42
gi|1384085|dbj|BAA08538.1| hemoglobin [Paramecium multimicronucl... 163 1e-39
gi|74830192|emb|CAI39023.1| globin, putative [Paramecium tetraur... 162 4e-39
gi|74830140|emb|CAI39013.1| globin, putative [Paramecium tetraur... 159 2e-38
gi|1384087|dbj|BAA08540.1| hemoglobin [Paramecium jenningsi] >gn... 159 2e-38
gi|74830134|emb|CAI39012.1| globin, putative [Paramecium tetraur... 158 4e-38
gi|53803300|ref|YP_114918.1| cyanobacterial globin family protei... 91 2e-17
gi|74830227|emb|CAI39030.1| globin, putative [Paramecium tetraur... 89 5e-17
gi|74830120|emb|CAI39009.1| globin, putative [Paramecium tetraur... 87 2e-16
gi|121274|sp|P17724|GLB_TETPY Myoglobin (Hemoglobin) >gnl|BL_ORD... 86 3e-16
gi|52842743|ref|YP_096542.1| myoglobin-like [Legionella pneumoph... 86 3e-16
gi|68176033|ref|ZP_00549258.1| Protozoan/cyanobacterial globin [... 85 6e-16
gi|437983|emb|CAA51421.1| Li637 [Chlamydomonas eugametos] >gnl|B... 84 1e-15
gi|68228966|ref|ZP_00568165.1| Protozoan/cyanobacterial globin [... 84 2e-15
gi|31792728|ref|NP_855221.1| Probable hemoglobin glbN [Mycobacte... 84 2e-15
gi|417052|sp|Q03459|GLB_TETTH Myoglobin (Hemoglobin) >gnl|BL_ORD... 83 2e-15
gi|54295372|ref|YP_127787.1| hypothetical protein lpl2457 [Legio... 82 5e-15
gi|54298537|ref|YP_124906.1| hypothetical protein lpp2601 [Legio... 82 7e-15
gi|47169308|pdb|1UVX|A Chain A, Heme-Ligand Tunneling On Group I... 81 1e-14
gi|437981|emb|CAA51420.1| Li410p [Chlamydomonas eugametos] >gnl|... 78 1e-13
gi|41407351|ref|NP_960187.1| GlbN [Mycobacterium avium subsp. pa... 77 1e-13
gi|76801362|ref|YP_326370.1| hypothetical protein NP1422A [Natro... 76 4e-13
gi|56460041|ref|YP_155322.1| Cyanoglobin family protein [Idiomar... 72 7e-12
gi|71063020|gb|AAZ22023.1| Bacterial-like globin [Candidatus Pel... 71 1e-11
gi|55232083|gb|AAV47502.1| cyanoglobin [Haloarcula marismortui A... 69 6e-11
gi|16330583|ref|NP_441311.1| cyanoglobin [Synechocystis sp. PCC ... 65 9e-10
gi|48425378|pdb|1RTX|A Chain A, Crystal Structure Of Synechocyst... 65 1e-09
gi|1100220|gb|AAB41122.1| cyanoglobin [Nostoc sp.] >gnl|BL_ORD_I... 64 1e-09
gi|23130505|ref|ZP_00112318.1| COG2346: Truncated hemoglobins [N... 63 3e-09
gi|18766961|gb|AAL79195.1| cyanoglobin [Synechococcus sp. PCC 7002] 62 4e-09
gi|232163|sp|Q00812|GLBN_NOSCO Cyanoglobin >gnl|BL_ORD_ID|146868... 62 5e-09
gi|32445985|emb|CAD78716.1| hemoglobin-like protein HbN [Rhodopi... 61 1e-08
gi|67859863|gb|EAM54924.1| Protozoan/cyanobacterial globin [Soli... 60 3e-08
gi|71737447|ref|YP_276073.1| protozoan/cyanobacterial globin fam... 58 9e-08
gi|28871348|ref|NP_793967.1| protozoan/cyanobacterial globin fam... 55 5e-07
gi|66047167|ref|YP_237008.1| Protozoan/cyanobacterial globin [Ps... 54 1e-06
gi|69951378|ref|ZP_00639119.1| Protozoan/cyanobacterial globin [... 54 2e-06
gi|23126739|ref|ZP_00108627.1| COG2346: Truncated hemoglobins [N... 54 2e-06
gi|76792214|ref|ZP_00774715.1| Protozoan/cyanobacterial globin [... 53 2e-06
gi|48861281|ref|ZP_00315184.1| COG2346: Truncated hemoglobins [M... 51 1e-05
gi|66857090|ref|ZP_00401147.1| hypothetical protein AdehDRAFT_13... 51 1e-05
gi|69159912|gb|EAN72013.1| protozoan/cyanobacterial globin famil... 50 3e-05
gi|47575085|ref|ZP_00245120.1| COG2346: Truncated hemoglobins [R... 49 5e-05
gi|74023464|ref|ZP_00694036.1| hypothetical protein RferDRAFT_08... 49 6e-05
gi|77359423|ref|YP_338998.1| putative protozoan/cyanobacterial g... 47 2e-04
gi|68546393|ref|ZP_00585940.1| Protozoan/cyanobacterial globin [... 46 3e-04
gi|66797340|ref|ZP_00396100.1| hypothetical protein DgeoDRAFT_15... 45 6e-04
gi|82497552|ref|ZP_00883085.1| protozoan/cyanobacterial globin f... 45 6e-04
gi|58427457|gb|AAW76494.1| cyanoglobin [Xanthomonas oryzae pv. o... 45 8e-04
gi|76260253|ref|ZP_00767892.1| Protozoan/cyanobacterial globin [... 45 0.001
gi|68518978|gb|EAN42528.1| Protozoan/cyanobacterial globin [Shew... 44 0.001
gi|21243436|ref|NP_643018.1| cyanoglobin [Xanthomonas axonopodis... 44 0.002
gi|21231965|ref|NP_637882.1| cyanoglobin [Xanthomonas campestris... 44 0.002
gi|78048414|ref|YP_364589.1| Globin [Xanthomonas campestris pv. ... 43 0.004
gi|10175475|dbj|BAB06573.1| BH2854 [Bacillus halodurans C-125] >... 42 0.005
gi|6855395|emb|CAB71209.1| putative globin [Streptomyces coelico... 42 0.006
gi|67542904|ref|ZP_00420838.1| Protozoan/cyanobacterial globin [... 41 0.013
gi|68447680|dbj|BAE05264.1| unnamed protein product [Staphylococ... 40 0.028
gi|74020566|ref|ZP_00691155.1| Protozoan/cyanobacterial globin [... 39 0.037
gi|13470534|ref|NP_102102.1| hypothetical protein mlr0267 [Mesor... 39 0.039
gi|29831913|ref|NP_826547.1| putative globin-like protein [Strep... 39 0.040
gi|68232479|ref|ZP_00571626.1| Protozoan/cyanobacterial globin [... 39 0.057
gi|56419360|ref|YP_146678.1| hypothetical protein GK0825 [Geobac... 39 0.060
gi|67986909|gb|EAM74717.1| Protozoan/cyanobacterial globin [Kine... 39 0.062
gi|68212276|ref|ZP_00564113.1| Protozoan/cyanobacterial globin [... 37 0.15
gi|48784261|ref|ZP_00280627.1| COG2346: Truncated hemoglobins [B... 37 0.18
gi|71366253|ref|ZP_00656798.1| Protozoan/cyanobacterial globin [... 37 0.19
gi|33593344|ref|NP_880988.1| globin-like protein [Bordetella per... 37 0.23
gi|41408389|ref|NP_961225.1| GlbO [Mycobacterium avium subsp. pa... 37 0.26
gi|65318572|ref|ZP_00391531.1| COG2346: Truncated hemoglobins [B... 36 0.37
gi|15827640|ref|NP_301903.1| hemoglobin-like, oxygen carrier [My... 35 0.55
gi|4883447|emb|CAB43160.1| putative globin [Mycobacterium leprae] 35 0.55
gi|73536268|pdb|2BMM|A Chain A, X-Ray Structure Of A Novel Therm... 35 0.62
gi|72162614|ref|YP_290271.1| similar to Truncated hemoglobins [T... 35 0.62
gi|48786054|ref|ZP_00282263.1| COG2346: Truncated hemoglobins [B... 35 0.71
gi|49477128|ref|YP_035435.1| globin family protein [Bacillus thu... 35 0.81
gi|68229245|ref|ZP_00568442.1| conserved hypothetical protein [F... 35 0.81
gi|47568403|ref|ZP_00239104.1| globin family protein [Bacillus c... 35 0.82
gi|20146186|dbj|BAB88980.1| hypothetical protein [Bacillus cereus] 35 1.0
gi|30019349|ref|NP_830980.1| Globin Family Protein [Bacillus cer... 35 1.0
gi|67847992|ref|ZP_00503110.1| Protozoan/cyanobacterial globin [... 34 1.4
gi|73663091|ref|YP_301872.1| putative hemoglobin-like protein [S... 34 1.5
gi|38234371|ref|NP_940138.1| Putative hemoglobin [Corynebacteriu... 33 2.2
gi|49244221|emb|CAG42647.1| protozoan/cyanobacterial globin fami... 33 2.5
gi|50954582|ref|YP_061870.1| globin-like protein [Leifsonia xyli... 33 2.7
gi|15157551|gb|AAK88117.1| AGR_C_4317p [Agrobacterium tumefacien... 33 2.7
gi|17936262|ref|NP_533052.1| hypothetical protein Atu2380 [Agrob... 33 2.7
gi|57284381|gb|AAW36475.1| protozoan/cyanobacterial globin famil... 33 2.8
gi|76783772|ref|ZP_00770962.1| COG2346: Truncated hemoglobins [M... 33 2.8
gi|31793651|ref|NP_856144.1| POSSIBLE GLOBIN (OXYGEN-BINDING PRO... 33 2.8
gi|67929246|ref|ZP_00522429.1| Protozoan/cyanobacterial globin:A... 33 2.9
gi|67533795|gb|EAM30551.1| Protozoan/cyanobacterial globin [Burk... 33 3.1
gi|78367002|ref|ZP_00837277.1| AMP-dependent synthetase and liga... 33 3.1
gi|29829858|ref|NP_824492.1| hypothetical protein SAV3316 [Strep... 33 3.4
gi|56678184|gb|AAV94850.1| protozoan/cyanobacterial globin famil... 33 3.7
gi|15075442|emb|CAC46998.1| CONSERVED HYPOTHETICAL PROTEIN [Sino... 33 3.8
gi|74019606|ref|ZP_00690220.1| Protozoan/cyanobacterial globin [... 32 4.4
gi|79039300|ref|ZP_00871006.1| similar to Truncated hemoglobins ... 32 5.3
gi|68054576|ref|ZP_00538733.1| Protozoan/cyanobacterial globin [... 32 6.2

Searching..................................................done

Results from round 2

Score E
Sequences producing significant alignments: (bits) Value
Sequences used in model and found again:

gi|71737447|ref|YP_276073.1| protozoan/cyanobacterial globin fam... 165 4e-40
gi|28871348|ref|NP_793967.1| protozoan/cyanobacterial globin fam... 164 6e-40
gi|68546393|ref|ZP_00585940.1| Protozoan/cyanobacterial globin [... 162 3e-39
gi|66047167|ref|YP_237008.1| Protozoan/cyanobacterial globin [Ps... 162 4e-39
gi|53803300|ref|YP_114918.1| cyanobacterial globin family protei... 162 4e-39
gi|56460041|ref|YP_155322.1| Cyanoglobin family protein [Idiomar... 158 4e-38
gi|121274|sp|P17724|GLB_TETPY Myoglobin (Hemoglobin) >gnl|BL_ORD... 158 6e-38
gi|77359423|ref|YP_338998.1| putative protozoan/cyanobacterial g... 157 7e-38
gi|7322057|gb|AAA29446.2| hemoglobin major component [Paramecium... 157 1e-37
gi|82497552|ref|ZP_00883085.1| protozoan/cyanobacterial globin f... 157 1e-37
gi|68518978|gb|EAN42528.1| Protozoan/cyanobacterial globin [Shew... 155 3e-37
gi|31792728|ref|NP_855221.1| Probable hemoglobin glbN [Mycobacte... 155 3e-37
gi|47169309|pdb|1UVY|A Chain A, Heme-Ligand Tunneling In Group I... 155 4e-37
gi|68176033|ref|ZP_00549258.1| Protozoan/cyanobacterial globin [... 155 5e-37
gi|415308|dbj|BAA02300.1| B-type of major hemoglobin component [... 155 5e-37
gi|437983|emb|CAA51421.1| Li637 [Chlamydomonas eugametos] >gnl|B... 154 7e-37
gi|76792214|ref|ZP_00774715.1| Protozoan/cyanobacterial globin [... 153 1e-36
gi|417052|sp|Q03459|GLB_TETTH Myoglobin (Hemoglobin) >gnl|BL_ORD... 153 1e-36
gi|68228966|ref|ZP_00568165.1| Protozoan/cyanobacterial globin [... 152 2e-36
gi|76801362|ref|YP_326370.1| hypothetical protein NP1422A [Natro... 152 3e-36
gi|58427457|gb|AAW76494.1| cyanoglobin [Xanthomonas oryzae pv. o... 152 3e-36
gi|47169308|pdb|1UVX|A Chain A, Heme-Ligand Tunneling On Group I... 151 7e-36
gi|74830192|emb|CAI39023.1| globin, putative [Paramecium tetraur... 150 2e-35
gi|1384085|dbj|BAA08538.1| hemoglobin [Paramecium multimicronucl... 150 2e-35
gi|41407351|ref|NP_960187.1| GlbN [Mycobacterium avium subsp. pa... 149 2e-35
gi|74830140|emb|CAI39013.1| globin, putative [Paramecium tetraur... 149 2e-35
gi|1384087|dbj|BAA08540.1| hemoglobin [Paramecium jenningsi] >gn... 149 2e-35
gi|47575085|ref|ZP_00245120.1| COG2346: Truncated hemoglobins [R... 148 4e-35
gi|74830134|emb|CAI39012.1| globin, putative [Paramecium tetraur... 148 4e-35
gi|12248875|dbj|BAB20310.1| hemoglobin [Paramecium caudatum] >gn... 148 4e-35
gi|69951378|ref|ZP_00639119.1| Protozoan/cyanobacterial globin [... 147 8e-35
gi|52842743|ref|YP_096542.1| myoglobin-like [Legionella pneumoph... 147 1e-34
gi|48861281|ref|ZP_00315184.1| COG2346: Truncated hemoglobins [M... 147 1e-34
gi|437981|emb|CAA51420.1| Li410p [Chlamydomonas eugametos] >gnl|... 146 2e-34
gi|74830120|emb|CAI39009.1| globin, putative [Paramecium tetraur... 145 3e-34
gi|74830227|emb|CAI39030.1| globin, putative [Paramecium tetraur... 145 4e-34
gi|69159912|gb|EAN72013.1| protozoan/cyanobacterial globin famil... 145 6e-34
gi|55232083|gb|AAV47502.1| cyanoglobin [Haloarcula marismortui A... 144 9e-34
gi|54298537|ref|YP_124906.1| hypothetical protein lpp2601 [Legio... 143 1e-33
gi|71063020|gb|AAZ22023.1| Bacterial-like globin [Candidatus Pel... 143 2e-33
gi|54295372|ref|YP_127787.1| hypothetical protein lpl2457 [Legio... 142 4e-33
gi|23126739|ref|ZP_00108627.1| COG2346: Truncated hemoglobins [N... 140 1e-32
gi|1100220|gb|AAB41122.1| cyanoglobin [Nostoc sp.] >gnl|BL_ORD_I... 140 1e-32
gi|67859863|gb|EAM54924.1| Protozoan/cyanobacterial globin [Soli... 140 2e-32
gi|23130505|ref|ZP_00112318.1| COG2346: Truncated hemoglobins [N... 139 2e-32
gi|48425378|pdb|1RTX|A Chain A, Crystal Structure Of Synechocyst... 137 1e-31
gi|16330583|ref|NP_441311.1| cyanoglobin [Synechocystis sp. PCC ... 137 1e-31
gi|232163|sp|Q00812|GLBN_NOSCO Cyanoglobin >gnl|BL_ORD_ID|146868... 136 2e-31
gi|74023464|ref|ZP_00694036.1| hypothetical protein RferDRAFT_08... 136 2e-31
gi|32445985|emb|CAD78716.1| hemoglobin-like protein HbN [Rhodopi... 135 4e-31
gi|18766961|gb|AAL79195.1| cyanoglobin [Synechococcus sp. PCC 7002] 135 6e-31
gi|76260253|ref|ZP_00767892.1| Protozoan/cyanobacterial globin [... 119 3e-26
gi|66857090|ref|ZP_00401147.1| hypothetical protein AdehDRAFT_13... 110 1e-23
gi|66797340|ref|ZP_00396100.1| hypothetical protein DgeoDRAFT_15... 85 6e-16

Sequences not found previously or not previously below threshold:

gi|21231965|ref|NP_637882.1| cyanoglobin [Xanthomonas campestris... 153 1e-36
gi|78048414|ref|YP_364589.1| Globin [Xanthomonas campestris pv. ... 150 2e-35
gi|21243436|ref|NP_643018.1| cyanoglobin [Xanthomonas axonopodis... 147 1e-34
gi|10175475|dbj|BAB06573.1| BH2854 [Bacillus halodurans C-125] >... 95 6e-19
gi|56419360|ref|YP_146678.1| hypothetical protein GK0825 [Geobac... 82 8e-15
gi|29831913|ref|NP_826547.1| putative globin-like protein [Strep... 80 2e-14
gi|68232479|ref|ZP_00571626.1| Protozoan/cyanobacterial globin [... 80 2e-14
gi|68175146|ref|ZP_00548400.1| Protozoan/cyanobacterial globin [... 80 3e-14
gi|73536268|pdb|2BMM|A Chain A, X-Ray Structure Of A Novel Therm... 79 4e-14
gi|72162614|ref|YP_290271.1| similar to Truncated hemoglobins [T... 79 4e-14
gi|13470534|ref|NP_102102.1| hypothetical protein mlr0267 [Mesor... 79 4e-14
gi|6855395|emb|CAB71209.1| putative globin [Streptomyces coelico... 78 9e-14
gi|50954582|ref|YP_061870.1| globin-like protein [Leifsonia xyli... 77 2e-13
gi|16078221|ref|NP_389038.1| hypothetical protein BSU11560 [Baci... 77 2e-13
gi|65318572|ref|ZP_00391531.1| COG2346: Truncated hemoglobins [B... 76 4e-13
gi|23098673|ref|NP_692139.1| hypothetical protein OB1218 [Oceano... 75 5e-13
gi|67929246|ref|ZP_00522429.1| Protozoan/cyanobacterial globin:A... 75 7e-13
gi|30019349|ref|NP_830980.1| Globin Family Protein [Bacillus cer... 75 8e-13
gi|47568403|ref|ZP_00239104.1| globin family protein [Bacillus c... 75 8e-13
gi|49477128|ref|YP_035435.1| globin family protein [Bacillus thu... 75 8e-13
gi|68447680|dbj|BAE05264.1| unnamed protein product [Staphylococ... 74 1e-12
gi|68229245|ref|ZP_00568442.1| conserved hypothetical protein [F... 74 1e-12
gi|68054576|ref|ZP_00538733.1| Protozoan/cyanobacterial globin [... 73 3e-12
gi|73663091|ref|YP_301872.1| putative hemoglobin-like protein [S... 73 3e-12
gi|20146186|dbj|BAB88980.1| hypothetical protein [Bacillus cereus] 73 3e-12
gi|71366253|ref|ZP_00656798.1| Protozoan/cyanobacterial globin [... 73 4e-12
gi|57284381|gb|AAW36475.1| protozoan/cyanobacterial globin famil... 72 5e-12
gi|49244221|emb|CAG42647.1| protozoan/cyanobacterial globin fami... 72 6e-12
gi|52002870|gb|AAU22812.1| conserved protein YjbI [Bacillus lich... 71 9e-12
gi|49483165|ref|YP_040389.1| protozoan/cyanobacterial globin fam... 71 1e-11
gi|29829858|ref|NP_824492.1| hypothetical protein SAV3316 [Strep... 71 1e-11
gi|38234371|ref|NP_940138.1| Putative hemoglobin [Corynebacteriu... 71 1e-11
gi|67986909|gb|EAM74717.1| Protozoan/cyanobacterial globin [Kine... 71 1e-11
gi|27467610|ref|NP_764247.1| hypothetical protein SE0692 [Staphy... 70 2e-11
gi|48854100|ref|ZP_00308264.1| COG2346: Truncated hemoglobins [C... 70 2e-11
gi|67542904|ref|ZP_00420838.1| Protozoan/cyanobacterial globin [... 70 2e-11
gi|57866545|ref|YP_188173.1| protozoan/cyanobacterial globin fam... 69 4e-11
gi|66797407|ref|ZP_00396166.1| Protozoan/cyanobacterial globin [... 68 9e-11
gi|56964289|ref|YP_176020.1| hypothetical protein ABC2524 [Bacil... 68 1e-10
gi|33593344|ref|NP_880988.1| globin-like protein [Bordetella per... 67 1e-10
gi|31793651|ref|NP_856144.1| POSSIBLE GLOBIN (OXYGEN-BINDING PRO... 67 2e-10
gi|66967031|ref|ZP_00414580.1| Protozoan/cyanobacterial globin [... 67 2e-10
gi|76783772|ref|ZP_00770962.1| COG2346: Truncated hemoglobins [M... 67 2e-10
gi|74316792|ref|YP_314532.1| putative oxygen-binding protein (gl... 67 3e-10
gi|15827640|ref|NP_301903.1| hemoglobin-like, oxygen carrier [My... 66 3e-10
gi|48786054|ref|ZP_00282263.1| COG2346: Truncated hemoglobins [B... 66 4e-10
gi|4883447|emb|CAB43160.1| putative globin [Mycobacterium leprae] 66 4e-10
gi|54023281|ref|YP_117523.1| putative globin [Nocardia farcinica... 65 5e-10
gi|66798373|ref|ZP_00397127.1| similar to Truncated hemoglobins ... 65 5e-10
gi|23494188|dbj|BAC19155.1| putative globin [Corynebacterium eff... 65 5e-10
gi|74020566|ref|ZP_00691155.1| Protozoan/cyanobacterial globin [... 65 7e-10
gi|56678184|gb|AAV94850.1| protozoan/cyanobacterial globin famil... 65 9e-10
gi|74019606|ref|ZP_00690220.1| Protozoan/cyanobacterial globin [... 64 1e-09
gi|68212276|ref|ZP_00564113.1| Protozoan/cyanobacterial globin [... 63 2e-09
gi|41408389|ref|NP_961225.1| GlbO [Mycobacterium avium subsp. pa... 63 2e-09
gi|53804116|ref|YP_114018.1| protozoan/cyanobacterial globin fam... 63 2e-09
gi|68263209|emb|CAI36697.1| hemoglobin-like protein [Corynebacte... 63 2e-09
gi|15806025|ref|NP_294726.1| hypothetical protein DR1002 [Deinoc... 63 4e-09
gi|17984557|gb|AAL53640.1| SEC-INDEPENDENT PROTEIN TRANSLOCASE P... 63 4e-09
gi|67661985|ref|ZP_00459276.1| Protozoan/cyanobacterial globin [... 62 4e-09
gi|23464267|gb|AAN34070.1| conserved hypothetical protein [Bruce... 62 5e-09
gi|62423976|ref|ZP_00379129.1| COG2346: Truncated hemoglobins [B... 62 6e-09
gi|19553644|ref|NP_601646.1| hemoglobin-like protein [Corynebact... 62 6e-09
gi|62317274|ref|YP_223127.1| hypothetical protein BruAb2_0335 [B... 62 6e-09
gi|78067075|ref|YP_369844.1| globin-like protein [Burkholderia s... 62 8e-09
gi|78777191|ref|YP_393506.1| globin [Thiomicrospira denitrifican... 61 1e-08
gi|78490029|ref|ZP_00842279.1| conserved hypothetical protein [R... 61 1e-08
gi|76809160|ref|YP_332811.1| protozoan/cyanobacterial globin fam... 60 2e-08
gi|53725407|ref|YP_103467.1| protozoan/cyanobacterial globin fam... 60 2e-08
gi|67761460|ref|ZP_00500169.1| COG2346: Truncated hemoglobins [B... 60 2e-08
gi|13774099|gb|AAK38159.1| putative globin [Burkholderia pseudom... 60 2e-08
gi|67636149|ref|ZP_00435097.1| COG2346: Truncated hemoglobins [B... 60 2e-08
gi|48784261|ref|ZP_00280627.1| COG2346: Truncated hemoglobins [B... 59 4e-08
gi|74019147|ref|ZP_00689765.1| conserved hypothetical protein [B... 59 5e-08
gi|78066619|ref|YP_369388.1| globin-like protein [Burkholderia s... 59 5e-08
gi|67543766|ref|ZP_00421697.1| conserved hypothetical protein [B... 58 7e-08
gi|67676504|ref|ZP_00473252.1| Protozoan/cyanobacterial globin [... 58 1e-07
gi|27376186|ref|NP_767715.1| hypothetical protein bll1075 [Brady... 58 1e-07
gi|39935786|ref|NP_948062.1| hypothetical protein RPA2719 [Rhodo... 57 2e-07
gi|67636465|ref|ZP_00435410.1| COG2346: Truncated hemoglobins [B... 57 2e-07
gi|68555581|ref|ZP_00594925.1| Protozoan/cyanobacterial globin [... 57 2e-07
gi|82527942|ref|ZP_00887239.1| COG2346: Truncated hemoglobins [B... 57 2e-07
gi|67669318|ref|ZP_00466159.1| COG2346: Truncated hemoglobins [B... 57 2e-07
gi|67158617|ref|ZP_00419523.1| Protozoan/cyanobacterial globin [... 57 2e-07
gi|42523942|ref|NP_969322.1| SEC-independent protein translocase... 56 4e-07
gi|78696276|ref|ZP_00860786.1| conserved hypothetical protein [B... 56 4e-07
gi|67670776|ref|ZP_00467575.1| COG2346: Truncated hemoglobins [B... 56 5e-07
gi|82410988|gb|ABB75097.1| globin family protein [Nitrosospira m... 55 6e-07
gi|48783812|ref|ZP_00280193.1| COG2346: Truncated hemoglobins [B... 55 6e-07
gi|78698246|ref|ZP_00862749.1| similar to Truncated hemoglobins ... 55 6e-07
gi|66267664|dbj|BAD98530.1| myoglobin-like protein [Pseudomonas ... 54 2e-06
gi|17429109|emb|CAD15797.1| PUTATIVE OXYGEN-BINDING PROTEIN (GLO... 53 2e-06
gi|75674939|ref|YP_317360.1| hypothetical protein Nwi_0742 [Nitr... 53 2e-06
gi|27381333|ref|NP_772862.1| probable Sec-independent protein tr... 52 4e-06
gi|68539244|ref|ZP_00579017.1| similar to Truncated hemoglobins ... 52 5e-06
gi|73540638|ref|YP_295158.1| Protozoan/cyanobacterial globin [Ra... 52 6e-06
gi|47573541|ref|ZP_00243579.1| COG2346: Truncated hemoglobins [R... 51 1e-05
gi|78696782|ref|ZP_00861291.1| probable oxygen-binding protein [... 51 1e-05
gi|44888958|gb|AAS48191.1| 2-on-2 hemoglobin [Glycine max] 51 1e-05
gi|79039300|ref|ZP_00871006.1| similar to Truncated hemoglobins ... 50 2e-05
gi|69929809|ref|ZP_00626686.1| conserved hypothetical protein [N... 50 3e-05
gi|68189460|gb|EAN04127.1| similar to Truncated hemoglobins [Mes... 50 3e-05
gi|34499146|ref|NP_903361.1| probable oxygen-binding protein [Ch... 50 3e-05
gi|79040927|ref|ZP_00872300.1| sec-independent protein transloca... 50 3e-05
gi|67847992|ref|ZP_00503110.1| Protozoan/cyanobacterial globin [... 49 4e-05
gi|13424704|gb|AAK25018.1| conserved hypothetical protein [Caulo... 49 4e-05
gi|15075602|emb|CAC47157.1| CONSERVED HYPOTHETICAL PROTEIN [Sino... 49 4e-05
gi|57240682|ref|ZP_00368630.1| conserved hypothetical protein [C... 49 5e-05
gi|71907626|ref|YP_285213.1| Protozoan/cyanobacterial globin [De... 49 6e-05
gi|7270173|emb|CAB79986.1| putative protein [Arabidopsis thalian... 48 6e-05
gi|15075442|emb|CAC46998.1| CONSERVED HYPOTHETICAL PROTEIN [Sino... 48 7e-05
gi|14165163|gb|AAK55409.1| 2-on-2 hemoglobin [Arabidopsis thaliana] 48 8e-05
gi|18418064|ref|NP_567901.1| GLB3 [Arabidopsis thaliana] >gnl|BL... 48 1e-04
gi|68548528|ref|ZP_00588023.1| Protozoan/cyanobacterial globin [... 48 1e-04
gi|54309529|ref|YP_130549.1| hypothetical protein PBPRA2362 [Pho... 48 1e-04
gi|15157551|gb|AAK88117.1| AGR_C_4317p [Agrobacterium tumefacien... 48 1e-04
gi|17936262|ref|NP_533052.1| hypothetical protein Atu2380 [Agrob... 47 1e-04
gi|56708976|ref|YP_165021.1| hypothetical protein SPOA0192 [Sili... 47 2e-04
gi|30249138|ref|NP_841208.1| possible sec-independent protein tr... 47 3e-04
gi|24371639|ref|NP_715681.1| hypothetical globin [Shewanella one... 47 3e-04
gi|69953395|ref|ZP_00640540.1| Protozoan/cyanobacterial globin [... 46 3e-04
gi|68519313|gb|EAN42852.1| Protozoan/cyanobacterial globin [Shew... 46 4e-04
gi|77814739|ref|ZP_00813993.1| Protozoan/cyanobacterial globin [... 46 4e-04
gi|53803809|ref|YP_114315.1| hypothetical protein MCA1878 [Methy... 46 4e-04
gi|42524058|ref|NP_969438.1| putative globin [Bdellovibrio bacte... 46 5e-04
gi|71549123|ref|ZP_00669330.1| possible sec-independent protein ... 45 6e-04
gi|78702870|ref|ZP_00867289.1| SEC-independent protein transloca... 45 6e-04
gi|54402092|gb|AAV34692.1| truncated hemoglobin HbO [Frankia sp.... 45 8e-04
gi|54402088|gb|AAV34690.1| truncated hemoglobin HbO [Frankia sp.... 45 8e-04
gi|78687608|ref|ZP_00852352.1| conserved hypothetical globin [Sh... 45 9e-04
gi|82497762|ref|ZP_00883290.1| conserved hypothetical globin [Sh... 45 0.001
gi|14165165|gb|AAK55410.1| 2-on-2 hemoglobin [Hordeum vulgare] 44 0.001
gi|78777890|ref|YP_394205.1| hypothetical protein Tmden_1693 [Th... 44 0.002
gi|33593122|ref|NP_880766.1| hypothetical protein BP2107 [Bordet... 44 0.002
gi|46400254|emb|CAF23703.1| conserved hypothetical protein [Para... 44 0.002
gi|77359012|ref|YP_338587.1| putative hemoglobin-like oxygen-bin... 43 0.003
gi|71548960|ref|ZP_00669184.1| conserved hypothetical protein [N... 43 0.003
gi|78690217|ref|ZP_00854867.1| conserved hypothetical globin [Sh... 43 0.003
gi|78366957|ref|ZP_00837232.1| Protozoan/cyanobacterial globin [... 43 0.003
gi|31559437|emb|CAD33536.1| 2-on-2 hemoglobin [Datisca glomerata] 43 0.003
gi|57168601|ref|ZP_00367734.1| conserved hypothetical protein [C... 42 0.005
gi|82409698|gb|ABB73807.1| possible sec-independent protein tran... 42 0.005
gi|69301286|ref|ZP_00622641.1| similar to Truncated hemoglobins ... 42 0.005
gi|77629907|ref|ZP_00792493.1| COG1018: Flavodoxin reductases (f... 42 0.006
gi|54402090|gb|AAV34691.1| truncated hemoglobin HbO [Frankia sp.... 42 0.007
gi|27085257|gb|AAN85433.1| hemoglobin Hb2 [Triticum aestivum] 42 0.007
gi|67533795|gb|EAM30551.1| Protozoan/cyanobacterial globin [Burk... 41 0.010
gi|24216675|ref|NP_714156.1| putative globin-like protein [Lepto... 41 0.010
gi|69156976|gb|EAN69248.1| Protozoan/cyanobacterial globin [Shew... 41 0.010
gi|57237519|ref|YP_178533.1| hypothetical protein CJE0515 [Campy... 41 0.011
gi|56679708|gb|AAV96374.1| conserved hypothetical protein [Silic... 41 0.011
gi|50725383|dbj|BAD32857.1| putative 2-on-2 hemoglobin [Oryza sa... 41 0.012
gi|79043629|ref|ZP_00874113.1| Protozoan/cyanobacterial globin [... 41 0.014
gi|77974696|ref|ZP_00830235.1| COG1018: Flavodoxin reductases (f... 40 0.028
gi|22125220|ref|NP_668643.1| dihydropteridine reductase [Yersini... 40 0.032
gi|6967936|emb|CAB75103.1| hypothetical protein Cj0465c [Campylo... 40 0.034
gi|77963400|ref|ZP_00827210.1| COG1018: Flavodoxin reductases (f... 39 0.041
gi|77958564|ref|ZP_00822595.1| COG1018: Flavodoxin reductases (f... 39 0.049
gi|37527172|ref|NP_930516.1| Flavohemoprotein (hemoglobin-like p... 39 0.060
gi|77976676|ref|ZP_00832152.1| COG1018: Flavodoxin reductases (f... 38 0.066
gi|45659001|ref|YP_003087.1| putative globin [Leptospira interro... 38 0.070
gi|66965830|ref|ZP_00413395.1| Globin:Oxidoreductase FAD/NAD(P)-... 38 0.072
gi|41409276|ref|NP_962112.1| hypothetical protein MAP3178c [Myco... 38 0.092
gi|59712923|ref|YP_205699.1| dihydropteridine reductase [Vibrio ... 38 0.10
gi|32261711|gb|AAP76761.1| conserved hypothetical protein [Helic... 37 0.18
gi|54402086|gb|AAV34689.1| truncated hemoglobin HbO [Frankia sp.... 37 0.19
gi|78488035|ref|ZP_00840287.1| globin-like protein [Rhodopseudom... 37 0.26
gi|2739247|emb|CAA05401.1| hypothetical protein [Campylobacter j... 36 0.37
gi|76791824|ref|ZP_00774328.1| Globin:Oxidoreductase FAD/NAD(P)-... 36 0.41
gi|56798252|dbj|BAD82894.1| DnaK [Burkholderia multivorans] 36 0.47
gi|78065313|ref|YP_368082.1| Heat shock protein Hsp70 [Burkholde... 36 0.49
gi|69937879|ref|ZP_00632465.1| sec-independent protein transloca... 36 0.49
gi|42547868|gb|EAA70711.1| hypothetical protein FG00765.1 [Gibbe... 36 0.52
gi|57242253|ref|ZP_00370192.1| conserved hypothetical protein [C... 35 0.54
gi|17934166|ref|NP_530956.1| hypothetical protein Atu0250 [Agrob... 35 0.55
gi|67547616|ref|ZP_00425517.1| Heat shock protein Hsp70 [Burkhol... 35 0.57
gi|74017079|ref|ZP_00687704.1| Heat shock protein Hsp70 [Burkhol... 35 0.59
gi|623536|gb|AAC41409.1| heat shock protein 70 >gnl|BL_ORD_ID|16... 35 0.59
gi|15073110|emb|CAC41569.1| HEAT SHOCK PROTEIN 70 (HSP70) CHAPER... 35 0.61
gi|623569|gb|AAA64925.1| heat shock protein 70 35 0.67
gi|67658246|ref|ZP_00455619.1| Heat shock protein Hsp70 [Burkhol... 35 0.86
gi|48862691|ref|ZP_00316586.1| COG2346: Truncated hemoglobins [M... 35 0.89
gi|67665867|ref|ZP_00463124.1| Heat shock protein Hsp70 [Burkhol... 35 0.92
gi|77361140|ref|YP_340715.1| conserved protein of unknown functi... 35 0.94
gi|15155141|gb|AAK86066.1| AGR_C_428p [Agrobacterium tumefaciens... 35 1.0
gi|58826452|gb|AAW82898.1| DnaK [Agrobacterium vitis] 35 1.1
gi|14547085|emb|CAC42483.1| heat shock protein 70 [Burkholderia ... 34 1.2
gi|76808695|ref|YP_334693.1| chaperone protein DnaK [Burkholderi... 34 1.4
gi|33602908|ref|NP_890468.1| molecular chaperone [Bordetella bro... 34 1.4
gi|67757437|ref|ZP_00496313.1| COG0443: Molecular chaperone [Bur... 34 1.4
gi|33598002|ref|NP_885645.1| molecular chaperone [Bordetella par... 34 1.5
gi|33593482|ref|NP_881126.1| molecular chaperone [Bordetella per... 34 1.5
gi|67637930|ref|ZP_00436868.1| COG0443: Molecular chaperone [Bur... 34 1.5
gi|20153414|ref|NP_619705.1| polyprotein [Grapevine chrome mosai... 34 1.5
gi|77361783|ref|YP_341358.1| two-domains flavohemoprotein: one i... 34 1.5
gi|67043793|gb|AAY63995.1| DnaK [Burkholderia mallei] 34 1.6
gi|67739500|ref|ZP_00490060.1| COG0443: Molecular chaperone [Bur... 34 1.6
gi|3095055|gb|AAC15473.1| heat shock protein 70 [Burkholderia ps... 34 1.6
gi|73542470|ref|YP_296990.1| Heat shock protein Hsp70 [Ralstonia... 34 1.6
gi|69302066|ref|ZP_00623162.1| chemotaxis sensory transducer [Si... 34 1.6
gi|66847126|gb|EAL87457.1| oxidoreductase, short-chain dehydroge... 34 1.7
gi|67761332|ref|ZP_00500042.1| COG0443: Molecular chaperone [Bur... 34 1.8
gi|77462229|ref|YP_351733.1| P-loop ATPase [Rhodobacter sphaeroi... 34 1.8
gi|479143|emb|CAA53500.1| hemoprotein X [Erwinia chrysanthemi] >... 34 1.9
gi|17429657|emb|CAD16342.1| PROBABLE HEAT SHOCK PROTEIN 70 (HSP7... 33 2.0
gi|20807854|ref|NP_623025.1| Uridylate kinase [Thermoanaerobacte... 33 2.1
gi|25013715|ref|NP_734047.1| protease cofactor [Grapevine chrome... 33 2.1
gi|28195138|gb|AAO33779.1| OphE [Agrobacterium tumefaciens] 33 2.2
gi|10955046|ref|NP_059702.1| ophE [Agrobacterium tumefaciens] >g... 33 2.2
gi|24211654|sp|Q8XW40|DNAK_RALSO Chaperone protein dnaK (Heat sh... 33 2.3
gi|48786660|ref|ZP_00282794.1| COG0443: Molecular chaperone [Bur... 33 2.3
gi|40362977|gb|AAR84665.1| DnaK [Agrobacterium tumefaciens] 33 2.4
gi|58826530|gb|AAW82902.1| DnaK [Rhizobium galegae] 33 2.5
gi|17934041|ref|NP_530831.1| DNAK Protein [Agrobacterium tumefac... 33 2.5
gi|56964872|ref|YP_176603.1| ribonucleoside-diphosphate reductas... 33 3.0
gi|73587269|gb|AAI03376.1| Annexin I [Bos taurus] >gnl|BL_ORD_ID... 33 3.2
gi|61553085|gb|AAX46348.1| annexin I [Bos taurus] 33 3.2
gi|59801772|ref|YP_208484.1| DnaK [Neisseria gonorrhoeae FA 1090... 33 3.4
gi|549383|sp|Q03240|VN35_ROTHD Nonstructural RNA-binding protein... 33 3.5
gi|74|emb|CAA39971.1| annexin I [Bos taurus] >gnl|BL_ORD_ID|1752... 33 3.6
gi|15600953|ref|NP_232583.1| ferrisiderophore reductase [Vibrio ... 33 3.7
gi|7379458|emb|CAB84020.1| putative chaperone protein [Neisseria... 33 3.7
gi|75820409|ref|ZP_00750457.1| COG1018: Flavodoxin reductases (f... 33 3.8
gi|75825810|ref|ZP_00755246.1| COG1018: Flavodoxin reductases (f... 33 3.9
gi|55793488|gb|AAV65738.1| NSp2 [Human rotavirus A] 33 4.0
gi|78494535|ref|ZP_00846763.1| Twin-arginine translocation pathw... 33 4.1
gi|72161160|ref|YP_288817.1| similar to Acyl-CoA synthetases (AM... 33 4.1
gi|47224934|emb|CAG06504.1| unnamed protein product [Tetraodon n... 33 4.2
gi|47204868|emb|CAF94395.1| unnamed protein product [Tetraodon n... 33 4.2
gi|75822935|ref|ZP_00752482.1| COG1018: Flavodoxin reductases (f... 33 4.2
gi|1165145|emb|CAA64477.1| annexin I [Sus scrofa] 33 4.4
gi|29832496|ref|NP_827130.1| putative flavohemoprotein [Streptom... 33 4.4
gi|34497098|ref|NP_901313.1| heat shock protein DnaK; chaperone ... 33 4.4
gi|58826435|gb|AAW82897.1| DnaK [Agrobacterium rubi] 32 4.5
gi|79041122|ref|ZP_00872495.1| uridylate kinase [Novosphingobium... 32 4.5
gi|28948618|pdb|1MCX|A Chain A, Structure Of Full-Length Annexin... 32 4.5
gi|20141168|sp|P19619|ANXA1_PIG Annexin A1 (Annexin I) (Lipocort... 32 4.7
gi|49612699|emb|CAG76149.1| flavohemoprotein [Erwinia carotovora... 32 4.7
gi|23015534|ref|ZP_00055307.1| COG0443: Molecular chaperone [Mag... 32 4.8
gi|68559484|ref|ZP_00598817.1| Heat shock protein Hsp70 [Ralston... 32 4.8
gi|32039132|ref|ZP_00137404.1| hypothetical protein Paer03001589... 32 5.7
gi|52695858|pdb|1TU9|A Chain A, Crystal Structure Of A Hypotheti... 32 5.9
gi|49076996|gb|AAT49624.1| PA3967 [synthetic construct] 32 5.9
gi|14590211|ref|NP_142276.1| hypothetical protein PH0287 [Pyroco... 32 6.2
gi|15676459|ref|NP_273598.1| dnaK protein [Neisseria meningitidi... 32 6.7
gi|78222696|ref|YP_384443.1| hypothetical protein Gmet_1484 [Geo... 32 6.9
gi|75228874|ref|ZP_00715475.1| COG1017: Hemoglobin-like flavopro... 32 7.4
gi|2342642|emb|CAA74982.1| dnaK [Rhizobium leguminosarum] >gnl|B... 32 7.4
gi|1771596|emb|CAA64262.1| NSP2 [Rotavirus] 32 7.5
gi|33324317|gb|AAQ07953.1| nonstructural protein NSP2 [Human rot... 32 7.5
gi|33324309|gb|AAQ07949.1| nonstructural protein NSP2 [Human rot... 31 7.6
gi|82498428|ref|ZP_00883926.1| flavohemoprotein [Shewanella sp. ... 31 7.7
gi|78692453|ref|ZP_00856974.1| flavohemoprotein [Shewanella sp. ... 31 7.7
gi|24413779|emb|CAD55461.1| conserved hypothetical protein [Stre... 31 7.8
gi|2808787|emb|CAA16216.1| cobalt transport integral membrane pr... 31 7.8
gi|78496538|ref|ZP_00848742.1| chemotaxis sensory transducer [Rh... 31 8.2
gi|36958908|gb|AAQ87333.1| Dihydroxyacetone kinase [Rhizobium sp... 31 8.5
gi|82545004|ref|YP_408951.1| dihydropteridine reductase [Shigell... 31 8.6
gi|68165272|gb|AAY87596.1| ferrisiderophore reductase [Vibrio ch... 31 9.2
gi|68165268|gb|AAY87594.1| ferrisiderophore reductase [Vibrio ch... 31 9.3
gi|47229237|emb|CAG03989.1| unnamed protein product [Tetraodon n... 31 9.3
gi|68165284|gb|AAY87602.1| ferrisiderophore reductase [Vibrio ch... 31 9.3
gi|24052976|gb|AAN44096.1| dihydropteridine reductase [Shigella ... 31 9.3
gi|75178147|ref|ZP_00698206.1| COG1018: Flavodoxin reductases (f... 31 9.6
gi|68165286|gb|AAY87603.1| ferrisiderophore reductase [Vibrio ch... 31 9.6
gi|3293255|gb|AAC39125.1| neural globin [Cerebratulus lacteus] >... 31 9.6
gi|81242075|gb|ABB62785.1| dihydropteridine reductase, ferriside... 31 9.7
gi|2155297|gb|AAB58934.1| globin XII [Chironomus thummi thummi] 31 9.8
gi|13421593|gb|AAK22415.1| methyl-accepting chemotaxis protein M... 31 9.8
gi|15080672|dbj|BAB62537.1| hemoglobin chain [Moina macrocopa] >... 31 9.9
gi|333787|gb|AAA47293.1| NCVP3 nonstructural glycoprotein [Simia... 31 10.0

Searching..................................................done

Results from round 3

Score E
Sequences producing significant alignments: (bits) Value
Sequences used in model and found again:

gi|10175475|dbj|BAB06573.1| BH2854 [Bacillus halodurans C-125] >... 142 3e-33
gi|68546393|ref|ZP_00585940.1| Protozoan/cyanobacterial globin [... 139 3e-32
gi|82497552|ref|ZP_00883085.1| protozoan/cyanobacterial globin f... 136 2e-31
gi|121274|sp|P17724|GLB_TETPY Myoglobin (Hemoglobin) >gnl|BL_ORD... 136 3e-31
gi|53803300|ref|YP_114918.1| cyanobacterial globin family protei... 135 3e-31
gi|65318572|ref|ZP_00391531.1| COG2346: Truncated hemoglobins [B... 135 4e-31
gi|30019349|ref|NP_830980.1| Globin Family Protein [Bacillus cer... 135 5e-31
gi|49477128|ref|YP_035435.1| globin family protein [Bacillus thu... 135 5e-31
gi|7322057|gb|AAA29446.2| hemoglobin major component [Paramecium... 135 5e-31
gi|76801362|ref|YP_326370.1| hypothetical protein NP1422A [Natro... 135 5e-31
gi|56419360|ref|YP_146678.1| hypothetical protein GK0825 [Geobac... 135 6e-31
gi|71737447|ref|YP_276073.1| protozoan/cyanobacterial globin fam... 135 6e-31
gi|68518978|gb|EAN42528.1| Protozoan/cyanobacterial globin [Shew... 134 9e-31
gi|28871348|ref|NP_793967.1| protozoan/cyanobacterial globin fam... 133 1e-30
gi|47568403|ref|ZP_00239104.1| globin family protein [Bacillus c... 133 1e-30
gi|68176033|ref|ZP_00549258.1| Protozoan/cyanobacterial globin [... 133 1e-30
gi|47169309|pdb|1UVY|A Chain A, Heme-Ligand Tunneling In Group I... 133 2e-30
gi|415308|dbj|BAA02300.1| B-type of major hemoglobin component [... 132 3e-30
gi|20146186|dbj|BAB88980.1| hypothetical protein [Bacillus cereus] 132 3e-30
gi|76792214|ref|ZP_00774715.1| Protozoan/cyanobacterial globin [... 132 4e-30
gi|16078221|ref|NP_389038.1| hypothetical protein BSU11560 [Baci... 132 4e-30
gi|31792728|ref|NP_855221.1| Probable hemoglobin glbN [Mycobacte... 131 6e-30
gi|77359423|ref|YP_338998.1| putative protozoan/cyanobacterial g... 131 7e-30
gi|52002870|gb|AAU22812.1| conserved protein YjbI [Bacillus lich... 131 9e-30
gi|1384087|dbj|BAA08540.1| hemoglobin [Paramecium jenningsi] >gn... 130 1e-29
gi|66047167|ref|YP_237008.1| Protozoan/cyanobacterial globin [Ps... 130 1e-29
gi|74830134|emb|CAI39012.1| globin, putative [Paramecium tetraur... 130 1e-29
gi|74830192|emb|CAI39023.1| globin, putative [Paramecium tetraur... 130 2e-29
gi|1384085|dbj|BAA08538.1| hemoglobin [Paramecium multimicronucl... 130 2e-29
gi|76260253|ref|ZP_00767892.1| Protozoan/cyanobacterial globin [... 130 2e-29
gi|74830140|emb|CAI39013.1| globin, putative [Paramecium tetraur... 130 2e-29
gi|69951378|ref|ZP_00639119.1| Protozoan/cyanobacterial globin [... 129 3e-29
gi|74019606|ref|ZP_00690220.1| Protozoan/cyanobacterial globin [... 129 3e-29
gi|56964289|ref|YP_176020.1| hypothetical protein ABC2524 [Bacil... 128 4e-29
gi|417052|sp|Q03459|GLB_TETTH Myoglobin (Hemoglobin) >gnl|BL_ORD... 128 5e-29
gi|74830120|emb|CAI39009.1| globin, putative [Paramecium tetraur... 128 7e-29
gi|21231965|ref|NP_637882.1| cyanoglobin [Xanthomonas campestris... 127 9e-29
gi|56460041|ref|YP_155322.1| Cyanoglobin family protein [Idiomar... 127 1e-28
gi|12248875|dbj|BAB20310.1| hemoglobin [Paramecium caudatum] >gn... 127 2e-28
gi|23098673|ref|NP_692139.1| hypothetical protein OB1218 [Oceano... 126 2e-28
gi|41407351|ref|NP_960187.1| GlbN [Mycobacterium avium subsp. pa... 126 2e-28
gi|69159912|gb|EAN72013.1| protozoan/cyanobacterial globin famil... 126 2e-28
gi|55232083|gb|AAV47502.1| cyanoglobin [Haloarcula marismortui A... 126 2e-28
gi|437983|emb|CAA51421.1| Li637 [Chlamydomonas eugametos] >gnl|B... 126 3e-28
gi|68228966|ref|ZP_00568165.1| Protozoan/cyanobacterial globin [... 126 3e-28
gi|47169308|pdb|1UVX|A Chain A, Heme-Ligand Tunneling On Group I... 125 4e-28
gi|74830227|emb|CAI39030.1| globin, putative [Paramecium tetraur... 125 5e-28
gi|33593344|ref|NP_880988.1| globin-like protein [Bordetella per... 125 6e-28
gi|78067075|ref|YP_369844.1| globin-like protein [Burkholderia s... 125 6e-28
gi|67661985|ref|ZP_00459276.1| Protozoan/cyanobacterial globin [... 124 8e-28
gi|74316792|ref|YP_314532.1| putative oxygen-binding protein (gl... 124 8e-28
gi|1100220|gb|AAB41122.1| cyanoglobin [Nostoc sp.] >gnl|BL_ORD_I... 124 9e-28
gi|72162614|ref|YP_290271.1| similar to Truncated hemoglobins [T... 124 9e-28
gi|53803809|ref|YP_114315.1| hypothetical protein MCA1878 [Methy... 124 9e-28
gi|68175146|ref|ZP_00548400.1| Protozoan/cyanobacterial globin [... 124 9e-28
gi|71063020|gb|AAZ22023.1| Bacterial-like globin [Candidatus Pel... 123 1e-27
gi|78048414|ref|YP_364589.1| Globin [Xanthomonas campestris pv. ... 123 1e-27
gi|68212276|ref|ZP_00564113.1| Protozoan/cyanobacterial globin [... 123 1e-27
gi|52842743|ref|YP_096542.1| myoglobin-like [Legionella pneumoph... 123 1e-27
gi|21243436|ref|NP_643018.1| cyanoglobin [Xanthomonas axonopodis... 123 1e-27
gi|47575085|ref|ZP_00245120.1| COG2346: Truncated hemoglobins [R... 123 2e-27
gi|13774099|gb|AAK38159.1| putative globin [Burkholderia pseudom... 123 2e-27
gi|23130505|ref|ZP_00112318.1| COG2346: Truncated hemoglobins [N... 123 2e-27
gi|54298537|ref|YP_124906.1| hypothetical protein lpp2601 [Legio... 123 2e-27
gi|76809160|ref|YP_332811.1| protozoan/cyanobacterial globin fam... 122 3e-27
gi|58427457|gb|AAW76494.1| cyanoglobin [Xanthomonas oryzae pv. o... 122 3e-27
gi|53725407|ref|YP_103467.1| protozoan/cyanobacterial globin fam... 122 3e-27
gi|29831913|ref|NP_826547.1| putative globin-like protein [Strep... 122 3e-27
gi|68232479|ref|ZP_00571626.1| Protozoan/cyanobacterial globin [... 122 4e-27
gi|437981|emb|CAA51420.1| Li410p [Chlamydomonas eugametos] >gnl|... 121 5e-27
gi|74020566|ref|ZP_00691155.1| Protozoan/cyanobacterial globin [... 121 5e-27
gi|67761460|ref|ZP_00500169.1| COG2346: Truncated hemoglobins [B... 121 5e-27
gi|67636149|ref|ZP_00435097.1| COG2346: Truncated hemoglobins [B... 121 5e-27
gi|6855395|emb|CAB71209.1| putative globin [Streptomyces coelico... 121 7e-27
gi|42524058|ref|NP_969438.1| putative globin [Bdellovibrio bacte... 120 1e-26
gi|54295372|ref|YP_127787.1| hypothetical protein lpl2457 [Legio... 120 1e-26
gi|73536268|pdb|2BMM|A Chain A, X-Ray Structure Of A Novel Therm... 120 1e-26
gi|67859863|gb|EAM54924.1| Protozoan/cyanobacterial globin [Soli... 120 1e-26
gi|68555581|ref|ZP_00594925.1| Protozoan/cyanobacterial globin [... 120 2e-26
gi|47573541|ref|ZP_00243579.1| COG2346: Truncated hemoglobins [R... 120 2e-26
gi|82410988|gb|ABB75097.1| globin family protein [Nitrosospira m... 119 2e-26
gi|48861281|ref|ZP_00315184.1| COG2346: Truncated hemoglobins [M... 119 3e-26
gi|232163|sp|Q00812|GLBN_NOSCO Cyanoglobin >gnl|BL_ORD_ID|146868... 118 4e-26
gi|34499146|ref|NP_903361.1| probable oxygen-binding protein [Ch... 118 4e-26
gi|74023464|ref|ZP_00694036.1| hypothetical protein RferDRAFT_08... 118 5e-26
gi|66797407|ref|ZP_00396166.1| Protozoan/cyanobacterial globin [... 118 7e-26
gi|48784261|ref|ZP_00280627.1| COG2346: Truncated hemoglobins [B... 118 8e-26
gi|57866545|ref|YP_188173.1| protozoan/cyanobacterial globin fam... 117 8e-26
gi|68447680|dbj|BAE05264.1| unnamed protein product [Staphylococ... 117 9e-26
gi|73540638|ref|YP_295158.1| Protozoan/cyanobacterial globin [Ra... 117 1e-25
gi|71366253|ref|ZP_00656798.1| Protozoan/cyanobacterial globin [... 116 2e-25
gi|27467610|ref|NP_764247.1| hypothetical protein SE0692 [Staphy... 116 2e-25
gi|50954582|ref|YP_061870.1| globin-like protein [Leifsonia xyli... 116 2e-25
gi|18766961|gb|AAL79195.1| cyanoglobin [Synechococcus sp. PCC 7002] 116 3e-25
gi|15806025|ref|NP_294726.1| hypothetical protein DR1002 [Deinoc... 115 3e-25
gi|54023281|ref|YP_117523.1| putative globin [Nocardia farcinica... 115 5e-25
gi|71907626|ref|YP_285213.1| Protozoan/cyanobacterial globin [De... 115 5e-25
gi|38234371|ref|NP_940138.1| Putative hemoglobin [Corynebacteriu... 115 7e-25
gi|48425378|pdb|1RTX|A Chain A, Crystal Structure Of Synechocyst... 115 7e-25
gi|49244221|emb|CAG42647.1| protozoan/cyanobacterial globin fami... 114 8e-25
gi|67986909|gb|EAM74717.1| Protozoan/cyanobacterial globin [Kine... 114 8e-25
gi|16330583|ref|NP_441311.1| cyanoglobin [Synechocystis sp. PCC ... 114 9e-25
gi|17429109|emb|CAD15797.1| PUTATIVE OXYGEN-BINDING PROTEIN (GLO... 114 9e-25
gi|67542904|ref|ZP_00420838.1| Protozoan/cyanobacterial globin [... 114 9e-25
gi|73663091|ref|YP_301872.1| putative hemoglobin-like protein [S... 114 1e-24
gi|49483165|ref|YP_040389.1| protozoan/cyanobacterial globin fam... 114 1e-24
gi|67670776|ref|ZP_00467575.1| COG2346: Truncated hemoglobins [B... 114 1e-24
gi|31793651|ref|NP_856144.1| POSSIBLE GLOBIN (OXYGEN-BINDING PRO... 114 1e-24
gi|48786054|ref|ZP_00282263.1| COG2346: Truncated hemoglobins [B... 113 1e-24
gi|66967031|ref|ZP_00414580.1| Protozoan/cyanobacterial globin [... 113 1e-24
gi|67158617|ref|ZP_00419523.1| Protozoan/cyanobacterial globin [... 113 1e-24
gi|57284381|gb|AAW36475.1| protozoan/cyanobacterial globin famil... 113 1e-24
gi|76783772|ref|ZP_00770962.1| COG2346: Truncated hemoglobins [M... 113 2e-24
gi|32445985|emb|CAD78716.1| hemoglobin-like protein HbN [Rhodopi... 113 2e-24
gi|4883447|emb|CAB43160.1| putative globin [Mycobacterium leprae] 113 3e-24
gi|15827640|ref|NP_301903.1| hemoglobin-like, oxygen carrier [My... 112 3e-24
gi|41408389|ref|NP_961225.1| GlbO [Mycobacterium avium subsp. pa... 112 4e-24
gi|77814739|ref|ZP_00813993.1| Protozoan/cyanobacterial globin [... 111 5e-24
gi|19553644|ref|NP_601646.1| hemoglobin-like protein [Corynebact... 111 6e-24
gi|23126739|ref|ZP_00108627.1| COG2346: Truncated hemoglobins [N... 111 8e-24
gi|23494188|dbj|BAC19155.1| putative globin [Corynebacterium eff... 110 1e-23
gi|78687608|ref|ZP_00852352.1| conserved hypothetical globin [Sh... 110 1e-23
gi|68519313|gb|EAN42852.1| Protozoan/cyanobacterial globin [Shew... 110 2e-23
gi|82497762|ref|ZP_00883290.1| conserved hypothetical globin [Sh... 110 2e-23
gi|24371639|ref|NP_715681.1| hypothetical globin [Shewanella one... 109 3e-23
gi|78696276|ref|ZP_00860786.1| conserved hypothetical protein [B... 109 4e-23
gi|48854100|ref|ZP_00308264.1| COG2346: Truncated hemoglobins [C... 109 4e-23
gi|68548528|ref|ZP_00588023.1| Protozoan/cyanobacterial globin [... 107 9e-23
gi|15075442|emb|CAC46998.1| CONSERVED HYPOTHETICAL PROTEIN [Sino... 107 9e-23
gi|27376186|ref|NP_767715.1| hypothetical protein bll1075 [Brady... 107 1e-22
gi|67847992|ref|ZP_00503110.1| Protozoan/cyanobacterial globin [... 107 1e-22
gi|69953395|ref|ZP_00640540.1| Protozoan/cyanobacterial globin [... 105 4e-22
gi|67929246|ref|ZP_00522429.1| Protozoan/cyanobacterial globin:A... 105 4e-22
gi|68263209|emb|CAI36697.1| hemoglobin-like protein [Corynebacte... 104 8e-22
gi|67676504|ref|ZP_00473252.1| Protozoan/cyanobacterial globin [... 103 2e-21
gi|13470534|ref|NP_102102.1| hypothetical protein mlr0267 [Mesor... 103 3e-21
gi|15157551|gb|AAK88117.1| AGR_C_4317p [Agrobacterium tumefacien... 103 3e-21
gi|17936262|ref|NP_533052.1| hypothetical protein Atu2380 [Agrob... 102 4e-21
gi|62423976|ref|ZP_00379129.1| COG2346: Truncated hemoglobins [B... 100 1e-20
gi|54309529|ref|YP_130549.1| hypothetical protein PBPRA2362 [Pho... 100 2e-20
gi|78696782|ref|ZP_00861291.1| probable oxygen-binding protein [... 100 3e-20
gi|68229245|ref|ZP_00568442.1| conserved hypothetical protein [F... 99 3e-20
gi|75674939|ref|YP_317360.1| hypothetical protein Nwi_0742 [Nitr... 99 5e-20
gi|79039300|ref|ZP_00871006.1| similar to Truncated hemoglobins ... 98 8e-20
gi|29829858|ref|NP_824492.1| hypothetical protein SAV3316 [Strep... 96 4e-19
gi|66857090|ref|ZP_00401147.1| hypothetical protein AdehDRAFT_13... 95 6e-19
gi|68054576|ref|ZP_00538733.1| Protozoan/cyanobacterial globin [... 95 7e-19
gi|69929809|ref|ZP_00626686.1| conserved hypothetical protein [N... 94 2e-18
gi|14165163|gb|AAK55409.1| 2-on-2 hemoglobin [Arabidopsis thaliana] 93 3e-18
gi|78490029|ref|ZP_00842279.1| conserved hypothetical protein [R... 93 3e-18
gi|7270173|emb|CAB79986.1| putative protein [Arabidopsis thalian... 93 3e-18
gi|18418064|ref|NP_567901.1| GLB3 [Arabidopsis thaliana] >gnl|BL... 92 4e-18
gi|53804116|ref|YP_114018.1| protozoan/cyanobacterial globin fam... 92 5e-18
gi|56678184|gb|AAV94850.1| protozoan/cyanobacterial globin famil... 92 8e-18
gi|39935786|ref|NP_948062.1| hypothetical protein RPA2719 [Rhodo... 91 9e-18
gi|44888958|gb|AAS48191.1| 2-on-2 hemoglobin [Glycine max] 90 2e-17
gi|23464267|gb|AAN34070.1| conserved hypothetical protein [Bruce... 90 3e-17
gi|17984557|gb|AAL53640.1| SEC-INDEPENDENT PROTEIN TRANSLOCASE P... 90 3e-17
gi|66797340|ref|ZP_00396100.1| hypothetical protein DgeoDRAFT_15... 90 3e-17
gi|66267664|dbj|BAD98530.1| myoglobin-like protein [Pseudomonas ... 90 3e-17
gi|14165165|gb|AAK55410.1| 2-on-2 hemoglobin [Hordeum vulgare] 89 3e-17
gi|74019147|ref|ZP_00689765.1| conserved hypothetical protein [B... 89 5e-17
gi|78066619|ref|YP_369388.1| globin-like protein [Burkholderia s... 89 5e-17
gi|62317274|ref|YP_223127.1| hypothetical protein BruAb2_0335 [B... 88 7e-17
gi|27381333|ref|NP_772862.1| probable Sec-independent protein tr... 88 8e-17
gi|42523942|ref|NP_969322.1| SEC-independent protein translocase... 88 9e-17
gi|78777191|ref|YP_393506.1| globin [Thiomicrospira denitrifican... 87 2e-16
gi|66798373|ref|ZP_00397127.1| similar to Truncated hemoglobins ... 87 2e-16
gi|67543766|ref|ZP_00421697.1| conserved hypothetical protein [B... 87 3e-16
gi|78698246|ref|ZP_00862749.1| similar to Truncated hemoglobins ... 86 4e-16
gi|68189460|gb|EAN04127.1| similar to Truncated hemoglobins [Mes... 85 6e-16
gi|67669318|ref|ZP_00466159.1| COG2346: Truncated hemoglobins [B... 83 2e-15
gi|67636465|ref|ZP_00435410.1| COG2346: Truncated hemoglobins [B... 83 2e-15
gi|57240682|ref|ZP_00368630.1| conserved hypothetical protein [C... 83 2e-15
gi|82527942|ref|ZP_00887239.1| COG2346: Truncated hemoglobins [B... 83 3e-15
gi|48783812|ref|ZP_00280193.1| COG2346: Truncated hemoglobins [B... 81 1e-14
gi|15075602|emb|CAC47157.1| CONSERVED HYPOTHETICAL PROTEIN [Sino... 80 2e-14
gi|68539244|ref|ZP_00579017.1| similar to Truncated hemoglobins ... 80 2e-14
gi|30249138|ref|NP_841208.1| possible sec-independent protein tr... 79 4e-14
gi|71549123|ref|ZP_00669330.1| possible sec-independent protein ... 78 7e-14
gi|13424704|gb|AAK25018.1| conserved hypothetical protein [Caulo... 78 1e-13
gi|56708976|ref|YP_165021.1| hypothetical protein SPOA0192 [Sili... 77 1e-13
gi|79040927|ref|ZP_00872300.1| sec-independent protein transloca... 77 1e-13
gi|33593122|ref|NP_880766.1| hypothetical protein BP2107 [Bordet... 77 2e-13
gi|46400254|emb|CAF23703.1| conserved hypothetical protein [Para... 75 5e-13
gi|78702870|ref|ZP_00867289.1| SEC-independent protein transloca... 73 4e-12
gi|78777890|ref|YP_394205.1| hypothetical protein Tmden_1693 [Th... 71 1e-11
gi|54402092|gb|AAV34692.1| truncated hemoglobin HbO [Frankia sp.... 65 7e-10
gi|54402088|gb|AAV34690.1| truncated hemoglobin HbO [Frankia sp.... 65 1e-09

Sequences not found previously or not previously below threshold:

gi|78690217|ref|ZP_00854867.1| conserved hypothetical globin [Sh... 111 7e-24
gi|69156976|gb|EAN69248.1| Protozoan/cyanobacterial globin [Shew... 106 3e-22
gi|78366957|ref|ZP_00837232.1| Protozoan/cyanobacterial globin [... 103 1e-21
gi|77359012|ref|YP_338587.1| putative hemoglobin-like oxygen-bin... 101 9e-21
gi|79043629|ref|ZP_00874113.1| Protozoan/cyanobacterial globin [... 98 1e-19
gi|50725383|dbj|BAD32857.1| putative 2-on-2 hemoglobin [Oryza sa... 89 4e-17
gi|27085257|gb|AAN85433.1| hemoglobin Hb2 [Triticum aestivum] 85 5e-16
gi|77361140|ref|YP_340715.1| conserved protein of unknown functi... 85 9e-16
gi|48862691|ref|ZP_00316586.1| COG2346: Truncated hemoglobins [M... 83 2e-15
gi|31559437|emb|CAD33536.1| 2-on-2 hemoglobin [Datisca glomerata] 83 2e-15
gi|57168601|ref|ZP_00367734.1| conserved hypothetical protein [C... 80 2e-14
gi|24216675|ref|NP_714156.1| putative globin-like protein [Lepto... 80 3e-14
gi|82409698|gb|ABB73807.1| possible sec-independent protein tran... 76 3e-13
gi|71548960|ref|ZP_00669184.1| conserved hypothetical protein [N... 75 6e-13
gi|6967936|emb|CAB75103.1| hypothetical protein Cj0465c [Campylo... 75 1e-12
gi|45659001|ref|YP_003087.1| putative globin [Leptospira interro... 74 1e-12
gi|57237519|ref|YP_178533.1| hypothetical protein CJE0515 [Campy... 74 1e-12
gi|67533795|gb|EAM30551.1| Protozoan/cyanobacterial globin [Burk... 74 2e-12
gi|69301286|ref|ZP_00622641.1| similar to Truncated hemoglobins ... 66 3e-10
gi|32261711|gb|AAP76761.1| conserved hypothetical protein [Helic... 65 9e-10
gi|75761257|ref|ZP_00741240.1| Globin Family Protein [Bacillus t... 64 1e-09
gi|56679708|gb|AAV96374.1| conserved hypothetical protein [Silic... 64 2e-09
gi|54402090|gb|AAV34691.1| truncated hemoglobin HbO [Frankia sp.... 63 2e-09
gi|67763011|ref|ZP_00501708.1| COG2346: Truncated hemoglobins [B... 62 4e-09
gi|82533471|ref|ZP_00892539.1| COG2346: Truncated hemoglobins [B... 62 5e-09
gi|17934166|ref|NP_530956.1| hypothetical protein Atu0250 [Agrob... 62 5e-09
gi|15155141|gb|AAK86066.1| AGR_C_428p [Agrobacterium tumefaciens... 62 9e-09
gi|2739247|emb|CAA05401.1| hypothetical protein [Campylobacter j... 61 1e-08
gi|69937879|ref|ZP_00632465.1| sec-independent protein transloca... 60 2e-08
gi|57242253|ref|ZP_00370192.1| conserved hypothetical protein [C... 57 2e-07
gi|41409276|ref|NP_962112.1| hypothetical protein MAP3178c [Myco... 55 8e-07
gi|54402086|gb|AAV34689.1| truncated hemoglobin HbO [Frankia sp.... 54 2e-06
gi|77629907|ref|ZP_00792493.1| COG1018: Flavodoxin reductases (f... 47 2e-04
gi|74021593|ref|ZP_00692180.1| conserved hypothetical protein [R... 46 3e-04
gi|22125220|ref|NP_668643.1| dihydropteridine reductase [Yersini... 45 8e-04
gi|77963400|ref|ZP_00827210.1| COG1018: Flavodoxin reductases (f... 43 0.003
gi|77958564|ref|ZP_00822595.1| COG1018: Flavodoxin reductases (f... 43 0.003
gi|77974696|ref|ZP_00830235.1| COG1018: Flavodoxin reductases (f... 42 0.006
gi|48786067|ref|ZP_00282276.1| COG2346: Truncated hemoglobins [B... 41 0.012
gi|77976676|ref|ZP_00832152.1| COG1018: Flavodoxin reductases (f... 41 0.015
gi|59712923|ref|YP_205699.1| dihydropteridine reductase [Vibrio ... 38 0.14
gi|76791824|ref|ZP_00774328.1| Globin:Oxidoreductase FAD/NAD(P)-... 36 0.46
gi|46915547|emb|CAG22319.1| hypothetical protein [Photobacterium... 35 0.55
gi|52695858|pdb|1TU9|A Chain A, Crystal Structure Of A Hypotheti... 35 0.76
gi|49612699|emb|CAG76149.1| flavohemoprotein [Erwinia carotovora... 35 0.82
gi|479143|emb|CAA53500.1| hemoprotein X [Erwinia chrysanthemi] >... 35 0.84
gi|49076996|gb|AAT49624.1| PA3967 [synthetic construct] 35 0.84
gi|68490250|ref|XP_711046.1| putative flavohemoglobin [Candida a... 35 0.87
gi|68490223|ref|XP_711060.1| putative flavohemoglobin [Candida a... 35 0.87
gi|37527172|ref|NP_930516.1| Flavohemoprotein (hemoglobin-like p... 35 0.91
gi|32039132|ref|ZP_00137404.1| hypothetical protein Paer03001589... 35 0.91
gi|507738|gb|AAA62190.1| Hmp 35 0.99
gi|28899583|ref|NP_799188.1| flavohemoprotein (flavohemoglobin) ... 35 1.0
gi|75855424|ref|ZP_00763075.1| COG1018: Flavodoxin reductases (f... 35 1.0
gi|62512166|sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-famil... 35 1.1
gi|11993939|ref|NP_031405.1| ATP-binding cassette, sub-family A ... 35 1.1
gi|82545004|ref|YP_408951.1| dihydropteridine reductase [Shigell... 34 1.3
gi|10955046|ref|NP_059702.1| ophE [Agrobacterium tumefaciens] >g... 34 1.3
gi|28195138|gb|AAO33779.1| OphE [Agrobacterium tumefaciens] 34 1.3
gi|24052976|gb|AAN44096.1| dihydropteridine reductase [Shigella ... 34 1.4
gi|75178147|ref|ZP_00698206.1| COG1018: Flavodoxin reductases (f... 34 1.5
gi|16130477|ref|NP_417047.1| dihydropteridine reductase, ferrisi... 34 1.5
gi|81242075|gb|ABB62785.1| dihydropteridine reductase, ferriside... 34 1.6
gi|75196570|ref|ZP_00706640.1| COG1018: Flavodoxin reductases (f... 34 1.7
gi|15803077|ref|NP_289108.1| dihydropteridine reductase, ferrisi... 34 1.7
gi|74313075|ref|YP_311494.1| dihydropteridine reductase, ferrisi... 34 1.7
gi|75228874|ref|ZP_00715475.1| COG1017: Hemoglobin-like flavopro... 34 1.7
gi|75257976|ref|ZP_00729450.1| COG1018: Flavodoxin reductases (f... 34 1.7
gi|50843514|ref|YP_056741.1| hypothetical protein PPA2072 [Propi... 34 1.7
gi|26248916|ref|NP_754956.1| Flavohemoprotein [Escherichia coli ... 34 1.7
gi|21739948|emb|CAD38995.1| hypothetical protein [Homo sapiens] 34 1.8
gi|68053794|ref|ZP_00537959.1| chemotaxis sensory transducer [Ex... 33 2.4
gi|71066001|ref|YP_264728.1| probable transcriptional regulator,... 33 2.5
gi|75820409|ref|ZP_00750457.1| COG1018: Flavodoxin reductases (f... 33 2.6
gi|15600953|ref|NP_232583.1| ferrisiderophore reductase [Vibrio ... 33 2.6
gi|35212137|dbj|BAC89513.1| glr1572 [Gloeobacter violaceus PCC 7... 33 2.6
gi|75825810|ref|ZP_00755246.1| COG1018: Flavodoxin reductases (f... 33 2.6
gi|66965830|ref|ZP_00413395.1| Globin:Oxidoreductase FAD/NAD(P)-... 33 2.6
gi|71838823|ref|ZP_00678579.1| Beta-ketoacyl synthase [Pelobacte... 33 2.8
gi|75822935|ref|ZP_00752482.1| COG1018: Flavodoxin reductases (f... 33 2.9
gi|14030861|gb|AAD13810.3| paraneoplastic neuronal antigen MA1 [... 33 3.0
gi|50302221|ref|XP_451044.1| unnamed protein product [Kluyveromy... 33 3.0
gi|55641029|ref|XP_510052.1| PREDICTED: paraneoplastic antigen M... 33 3.1
gi|10173118|dbj|BAB04224.1| methyl-accepting chemotaxis protein ... 33 3.1
gi|27364701|ref|NP_760229.1| Flavodoxin reductase [Vibrio vulnif... 33 3.5
gi|48766282|ref|ZP_00270832.1| COG0840: Methyl-accepting chemota... 33 3.6
gi|16421102|gb|AAL21450.1| dihydropteridine reductase 2 [Salmone... 33 4.2
gi|62181121|ref|YP_217538.1| dihydropteridine reductase 2 and ni... 33 4.4
gi|29140834|ref|NP_804176.1| flavohemoprotein [Salmonella enteri... 32 4.6
gi|2738912|gb|AAC24484.1| flavohemoglobin [Salmonella typhimurium] 32 4.6
gi|56412566|ref|YP_149641.1| flavohemoprotein (haemoglobin-like ... 32 4.6
gi|47574756|ref|ZP_00244792.1| hypothetical protein Rgel02001621... 32 4.6
gi|66910991|gb|AAH97291.1| Pnma1 protein [Rattus norvegicus] >gn... 32 5.0
gi|68363998|ref|XP_690771.1| PREDICTED: similar to DNA-dependent... 32 6.4
gi|77742877|ref|ZP_00811351.1| IMP dehydrogenase/GMP reductase [... 32 6.5
gi|59801772|ref|YP_208484.1| DnaK [Neisseria gonorrhoeae FA 1090... 32 7.0
gi|7379458|emb|CAB84020.1| putative chaperone protein [Neisseria... 32 7.3
gi|71839690|ref|ZP_00679434.1| hypothetical protein PproDRAFT_03... 32 7.6
gi|23014982|ref|ZP_00054774.1| COG0840: Methyl-accepting chemota... 31 8.3
gi|49259432|pdb|1V07|A Chain A, Crystal Structure Of Thre11val M... 31 8.5
gi|15075776|emb|CAC47331.1| PUTATIVE OXIDOREDUCTASE PROTEIN [Sin... 31 8.7
gi|418282|sp|P32508|VP2_BTV1S Outer capsid protein VP2 31 9.0
gi|15676459|ref|NP_273598.1| dnaK protein [Neisseria meningitidi... 31 9.3
gi|3293255|gb|AAC39125.1| neural globin [Cerebratulus lacteus] >... 31 9.3
gi|68124225|emb|CAJ06987.1| ubiquitin-protein ligase-like, putat... 31 9.4
gi|78366901|ref|ZP_00837177.1| Globin [Shewanella sp. PV-4] >gnl... 31 9.6
gi|73964283|ref|XP_547896.2| PREDICTED: similar to Paraneoplasti... 31 9.7

Searching..................................................done

Results from round 4

Score E
Sequences producing significant alignments: (bits) Value
Sequences used in model and found again:

gi|10175475|dbj|BAB06573.1| BH2854 [Bacillus halodurans C-125] >... 142 3e-33
gi|74019606|ref|ZP_00690220.1| Protozoan/cyanobacterial globin [... 139 3e-32
gi|65318572|ref|ZP_00391531.1| COG2346: Truncated hemoglobins [B... 136 2e-31
gi|30019349|ref|NP_830980.1| Globin Family Protein [Bacillus cer... 135 3e-31
gi|49477128|ref|YP_035435.1| globin family protein [Bacillus thu... 135 3e-31
gi|56419360|ref|YP_146678.1| hypothetical protein GK0825 [Geobac... 135 6e-31
gi|68175146|ref|ZP_00548400.1| Protozoan/cyanobacterial globin [... 135 6e-31
gi|47568403|ref|ZP_00239104.1| globin family protein [Bacillus c... 134 9e-31
gi|67661985|ref|ZP_00459276.1| Protozoan/cyanobacterial globin [... 133 1e-30
gi|78067075|ref|YP_369844.1| globin-like protein [Burkholderia s... 133 1e-30
gi|13774099|gb|AAK38159.1| putative globin [Burkholderia pseudom... 133 2e-30
gi|20146186|dbj|BAB88980.1| hypothetical protein [Bacillus cereus] 133 2e-30
gi|76260253|ref|ZP_00767892.1| Protozoan/cyanobacterial globin [... 132 3e-30
gi|72162614|ref|YP_290271.1| similar to Truncated hemoglobins [T... 132 3e-30
gi|71366253|ref|ZP_00656798.1| Protozoan/cyanobacterial globin [... 132 3e-30
gi|76809160|ref|YP_332811.1| protozoan/cyanobacterial globin fam... 132 4e-30
gi|68546393|ref|ZP_00585940.1| Protozoan/cyanobacterial globin [... 132 4e-30
gi|53725407|ref|YP_103467.1| protozoan/cyanobacterial globin fam... 132 4e-30
gi|16078221|ref|NP_389038.1| hypothetical protein BSU11560 [Baci... 132 5e-30
gi|68232479|ref|ZP_00571626.1| Protozoan/cyanobacterial globin [... 132 5e-30
gi|74316792|ref|YP_314532.1| putative oxygen-binding protein (gl... 131 6e-30
gi|29831913|ref|NP_826547.1| putative globin-like protein [Strep... 131 6e-30
gi|33593344|ref|NP_880988.1| globin-like protein [Bordetella per... 131 7e-30
gi|68555581|ref|ZP_00594925.1| Protozoan/cyanobacterial globin [... 131 8e-30
gi|67761460|ref|ZP_00500169.1| COG2346: Truncated hemoglobins [B... 131 8e-30
gi|52002870|gb|AAU22812.1| conserved protein YjbI [Bacillus lich... 131 8e-30
gi|67636149|ref|ZP_00435097.1| COG2346: Truncated hemoglobins [B... 130 9e-30
gi|6855395|emb|CAB71209.1| putative globin [Streptomyces coelico... 130 1e-29
gi|82410988|gb|ABB75097.1| globin family protein [Nitrosospira m... 130 1e-29
gi|68212276|ref|ZP_00564113.1| Protozoan/cyanobacterial globin [... 130 1e-29
gi|53803809|ref|YP_114315.1| hypothetical protein MCA1878 [Methy... 130 1e-29
gi|42524058|ref|NP_969438.1| putative globin [Bdellovibrio bacte... 130 1e-29
gi|76801362|ref|YP_326370.1| hypothetical protein NP1422A [Natro... 129 2e-29
gi|73540638|ref|YP_295158.1| Protozoan/cyanobacterial globin [Ra... 128 4e-29
gi|82497552|ref|ZP_00883085.1| protozoan/cyanobacterial globin f... 127 8e-29
gi|68176033|ref|ZP_00549258.1| Protozoan/cyanobacterial globin [... 127 8e-29
gi|56964289|ref|YP_176020.1| hypothetical protein ABC2524 [Bacil... 127 8e-29
gi|47573541|ref|ZP_00243579.1| COG2346: Truncated hemoglobins [R... 127 9e-29
gi|74020566|ref|ZP_00691155.1| Protozoan/cyanobacterial globin [... 127 1e-28
gi|48784261|ref|ZP_00280627.1| COG2346: Truncated hemoglobins [B... 127 1e-28
gi|121274|sp|P17724|GLB_TETPY Myoglobin (Hemoglobin) >gnl|BL_ORD... 127 1e-28
gi|68518978|gb|EAN42528.1| Protozoan/cyanobacterial globin [Shew... 127 1e-28
gi|73536268|pdb|2BMM|A Chain A, X-Ray Structure Of A Novel Therm... 127 1e-28
gi|71907626|ref|YP_285213.1| Protozoan/cyanobacterial globin [De... 126 2e-28
gi|48786054|ref|ZP_00282263.1| COG2346: Truncated hemoglobins [B... 126 2e-28
gi|53803300|ref|YP_114918.1| cyanobacterial globin family protei... 126 3e-28
gi|34499146|ref|NP_903361.1| probable oxygen-binding protein [Ch... 125 3e-28
gi|7322057|gb|AAA29446.2| hemoglobin major component [Paramecium... 125 3e-28
gi|47169309|pdb|1UVY|A Chain A, Heme-Ligand Tunneling In Group I... 124 8e-28
gi|67986909|gb|EAM74717.1| Protozoan/cyanobacterial globin [Kine... 124 9e-28
gi|23098673|ref|NP_692139.1| hypothetical protein OB1218 [Oceano... 124 1e-27
gi|50954582|ref|YP_061870.1| globin-like protein [Leifsonia xyli... 123 1e-27
gi|66967031|ref|ZP_00414580.1| Protozoan/cyanobacterial globin [... 123 1e-27
gi|415308|dbj|BAA02300.1| B-type of major hemoglobin component [... 123 1e-27
gi|17429109|emb|CAD15797.1| PUTATIVE OXYGEN-BINDING PROTEIN (GLO... 123 2e-27
gi|31792728|ref|NP_855221.1| Probable hemoglobin glbN [Mycobacte... 123 2e-27
gi|67670776|ref|ZP_00467575.1| COG2346: Truncated hemoglobins [B... 123 2e-27
gi|1384087|dbj|BAA08540.1| hemoglobin [Paramecium jenningsi] >gn... 123 2e-27
gi|4883447|emb|CAB43160.1| putative globin [Mycobacterium leprae] 123 2e-27
gi|67542904|ref|ZP_00420838.1| Protozoan/cyanobacterial globin [... 122 3e-27
gi|74830134|emb|CAI39012.1| globin, putative [Paramecium tetraur... 122 3e-27
gi|15827640|ref|NP_301903.1| hemoglobin-like, oxygen carrier [My... 122 3e-27
gi|19553644|ref|NP_601646.1| hemoglobin-like protein [Corynebact... 122 3e-27
gi|71737447|ref|YP_276073.1| protozoan/cyanobacterial globin fam... 122 3e-27
gi|74830140|emb|CAI39013.1| globin, putative [Paramecium tetraur... 122 4e-27
gi|74830192|emb|CAI39023.1| globin, putative [Paramecium tetraur... 122 4e-27
gi|38234371|ref|NP_940138.1| Putative hemoglobin [Corynebacteriu... 122 4e-27
gi|54023281|ref|YP_117523.1| putative globin [Nocardia farcinica... 122 5e-27
gi|1384085|dbj|BAA08538.1| hemoglobin [Paramecium multimicronucl... 122 5e-27
gi|78696276|ref|ZP_00860786.1| conserved hypothetical protein [B... 122 5e-27
gi|31793651|ref|NP_856144.1| POSSIBLE GLOBIN (OXYGEN-BINDING PRO... 122 5e-27
gi|28871348|ref|NP_793967.1| protozoan/cyanobacterial globin fam... 121 6e-27
gi|67158617|ref|ZP_00419523.1| Protozoan/cyanobacterial globin [... 121 6e-27
gi|68228966|ref|ZP_00568165.1| Protozoan/cyanobacterial globin [... 121 6e-27
gi|41408389|ref|NP_961225.1| GlbO [Mycobacterium avium subsp. pa... 121 7e-27
gi|68548528|ref|ZP_00588023.1| Protozoan/cyanobacterial globin [... 121 8e-27
gi|76783772|ref|ZP_00770962.1| COG2346: Truncated hemoglobins [M... 121 9e-27
gi|78690217|ref|ZP_00854867.1| conserved hypothetical globin [Sh... 121 9e-27
gi|69951378|ref|ZP_00639119.1| Protozoan/cyanobacterial globin [... 120 1e-26
gi|55232083|gb|AAV47502.1| cyanoglobin [Haloarcula marismortui A... 120 1e-26
gi|76792214|ref|ZP_00774715.1| Protozoan/cyanobacterial globin [... 120 1e-26
gi|74830120|emb|CAI39009.1| globin, putative [Paramecium tetraur... 120 2e-26
gi|82497762|ref|ZP_00883290.1| conserved hypothetical globin [Sh... 120 2e-26
gi|78687608|ref|ZP_00852352.1| conserved hypothetical globin [Sh... 120 2e-26
gi|66797407|ref|ZP_00396166.1| Protozoan/cyanobacterial globin [... 119 2e-26
gi|437983|emb|CAA51421.1| Li637 [Chlamydomonas eugametos] >gnl|B... 119 2e-26
gi|417052|sp|Q03459|GLB_TETTH Myoglobin (Hemoglobin) >gnl|BL_ORD... 119 3e-26
gi|41407351|ref|NP_960187.1| GlbN [Mycobacterium avium subsp. pa... 118 4e-26
gi|47169308|pdb|1UVX|A Chain A, Heme-Ligand Tunneling On Group I... 118 4e-26
gi|23494188|dbj|BAC19155.1| putative globin [Corynebacterium eff... 118 4e-26
gi|77359423|ref|YP_338998.1| putative protozoan/cyanobacterial g... 118 5e-26
gi|66047167|ref|YP_237008.1| Protozoan/cyanobacterial globin [Ps... 118 5e-26
gi|15157551|gb|AAK88117.1| AGR_C_4317p [Agrobacterium tumefacien... 118 6e-26
gi|12248875|dbj|BAB20310.1| hemoglobin [Paramecium caudatum] >gn... 118 6e-26
gi|77814739|ref|ZP_00813993.1| Protozoan/cyanobacterial globin [... 118 6e-26
gi|24371639|ref|NP_715681.1| hypothetical globin [Shewanella one... 118 6e-26
gi|27376186|ref|NP_767715.1| hypothetical protein bll1075 [Brady... 118 7e-26
gi|15075442|emb|CAC46998.1| CONSERVED HYPOTHETICAL PROTEIN [Sino... 118 7e-26
gi|69156976|gb|EAN69248.1| Protozoan/cyanobacterial globin [Shew... 118 8e-26
gi|1100220|gb|AAB41122.1| cyanoglobin [Nostoc sp.] >gnl|BL_ORD_I... 117 9e-26
gi|74830227|emb|CAI39030.1| globin, putative [Paramecium tetraur... 117 1e-25
gi|17936262|ref|NP_533052.1| hypothetical protein Atu2380 [Agrob... 117 1e-25
gi|68519313|gb|EAN42852.1| Protozoan/cyanobacterial globin [Shew... 117 1e-25
gi|78366957|ref|ZP_00837232.1| Protozoan/cyanobacterial globin [... 117 1e-25
gi|69159912|gb|EAN72013.1| protozoan/cyanobacterial globin famil... 117 1e-25
gi|71063020|gb|AAZ22023.1| Bacterial-like globin [Candidatus Pel... 117 1e-25
gi|23130505|ref|ZP_00112318.1| COG2346: Truncated hemoglobins [N... 117 1e-25
gi|21231965|ref|NP_637882.1| cyanoglobin [Xanthomonas campestris... 117 1e-25
gi|69953395|ref|ZP_00640540.1| Protozoan/cyanobacterial globin [... 116 2e-25
gi|15806025|ref|NP_294726.1| hypothetical protein DR1002 [Deinoc... 116 2e-25
gi|57866545|ref|YP_188173.1| protozoan/cyanobacterial globin fam... 116 3e-25
gi|68447680|dbj|BAE05264.1| unnamed protein product [Staphylococ... 115 4e-25
gi|437981|emb|CAA51420.1| Li410p [Chlamydomonas eugametos] >gnl|... 115 4e-25
gi|56460041|ref|YP_155322.1| Cyanoglobin family protein [Idiomar... 115 6e-25
gi|67847992|ref|ZP_00503110.1| Protozoan/cyanobacterial globin [... 115 6e-25
gi|54298537|ref|YP_124906.1| hypothetical protein lpp2601 [Legio... 114 7e-25
gi|47575085|ref|ZP_00245120.1| COG2346: Truncated hemoglobins [R... 114 8e-25
gi|21243436|ref|NP_643018.1| cyanoglobin [Xanthomonas axonopodis... 114 8e-25
gi|78048414|ref|YP_364589.1| Globin [Xanthomonas campestris pv. ... 114 9e-25
gi|52842743|ref|YP_096542.1| myoglobin-like [Legionella pneumoph... 113 1e-24
gi|27467610|ref|NP_764247.1| hypothetical protein SE0692 [Staphy... 113 1e-24
gi|58427457|gb|AAW76494.1| cyanoglobin [Xanthomonas oryzae pv. o... 112 3e-24
gi|232163|sp|Q00812|GLBN_NOSCO Cyanoglobin >gnl|BL_ORD_ID|146868... 112 4e-24
gi|79043629|ref|ZP_00874113.1| Protozoan/cyanobacterial globin [... 112 4e-24
gi|48425378|pdb|1RTX|A Chain A, Crystal Structure Of Synechocyst... 112 5e-24
gi|67929246|ref|ZP_00522429.1| Protozoan/cyanobacterial globin:A... 111 6e-24
gi|49244221|emb|CAG42647.1| protozoan/cyanobacterial globin fami... 111 7e-24
gi|77359012|ref|YP_338587.1| putative hemoglobin-like oxygen-bin... 111 7e-24
gi|48854100|ref|ZP_00308264.1| COG2346: Truncated hemoglobins [C... 111 8e-24
gi|16330583|ref|NP_441311.1| cyanoglobin [Synechocystis sp. PCC ... 111 8e-24
gi|68263209|emb|CAI36697.1| hemoglobin-like protein [Corynebacte... 111 8e-24
gi|54295372|ref|YP_127787.1| hypothetical protein lpl2457 [Legio... 111 9e-24
gi|49483165|ref|YP_040389.1| protozoan/cyanobacterial globin fam... 110 1e-23
gi|73663091|ref|YP_301872.1| putative hemoglobin-like protein [S... 110 1e-23
gi|62423976|ref|ZP_00379129.1| COG2346: Truncated hemoglobins [B... 110 1e-23
gi|57284381|gb|AAW36475.1| protozoan/cyanobacterial globin famil... 110 1e-23
gi|67859863|gb|EAM54924.1| Protozoan/cyanobacterial globin [Soli... 110 1e-23
gi|54309529|ref|YP_130549.1| hypothetical protein PBPRA2362 [Pho... 109 2e-23
gi|57168601|ref|ZP_00367734.1| conserved hypothetical protein [C... 109 3e-23
gi|48861281|ref|ZP_00315184.1| COG2346: Truncated hemoglobins [M... 109 3e-23
gi|75674939|ref|YP_317360.1| hypothetical protein Nwi_0742 [Nitr... 109 3e-23
gi|67676504|ref|ZP_00473252.1| Protozoan/cyanobacterial globin [... 108 5e-23
gi|74023464|ref|ZP_00694036.1| hypothetical protein RferDRAFT_08... 108 5e-23
gi|78696782|ref|ZP_00861291.1| probable oxygen-binding protein [... 107 1e-22
gi|18766961|gb|AAL79195.1| cyanoglobin [Synechococcus sp. PCC 7002] 107 2e-22
gi|13470534|ref|NP_102102.1| hypothetical protein mlr0267 [Mesor... 105 4e-22
gi|69929809|ref|ZP_00626686.1| conserved hypothetical protein [N... 104 1e-21
gi|6967936|emb|CAB75103.1| hypothetical protein Cj0465c [Campylo... 104 1e-21
gi|32445985|emb|CAD78716.1| hemoglobin-like protein HbN [Rhodopi... 103 2e-21
gi|57237519|ref|YP_178533.1| hypothetical protein CJE0515 [Campy... 103 2e-21
gi|79039300|ref|ZP_00871006.1| similar to Truncated hemoglobins ... 102 4e-21
gi|39935786|ref|NP_948062.1| hypothetical protein RPA2719 [Rhodo... 100 1e-20
gi|24216675|ref|NP_714156.1| putative globin-like protein [Lepto... 100 1e-20
gi|17984557|gb|AAL53640.1| SEC-INDEPENDENT PROTEIN TRANSLOCASE P... 100 2e-20
gi|68229245|ref|ZP_00568442.1| conserved hypothetical protein [F... 100 2e-20
gi|78490029|ref|ZP_00842279.1| conserved hypothetical protein [R... 100 2e-20
gi|48862691|ref|ZP_00316586.1| COG2346: Truncated hemoglobins [M... 100 2e-20
gi|23464267|gb|AAN34070.1| conserved hypothetical protein [Bruce... 100 3e-20
gi|77361140|ref|YP_340715.1| conserved protein of unknown functi... 100 3e-20
gi|57240682|ref|ZP_00368630.1| conserved hypothetical protein [C... 99 4e-20
gi|14165163|gb|AAK55409.1| 2-on-2 hemoglobin [Arabidopsis thaliana] 99 4e-20
gi|62317274|ref|YP_223127.1| hypothetical protein BruAb2_0335 [B... 99 4e-20
gi|27381333|ref|NP_772862.1| probable Sec-independent protein tr... 99 5e-20
gi|18418064|ref|NP_567901.1| GLB3 [Arabidopsis thaliana] >gnl|BL... 99 6e-20
gi|29829858|ref|NP_824492.1| hypothetical protein SAV3316 [Strep... 98 7e-20
gi|23126739|ref|ZP_00108627.1| COG2346: Truncated hemoglobins [N... 98 8e-20
gi|7270173|emb|CAB79986.1| putative protein [Arabidopsis thalian... 98 1e-19
gi|68054576|ref|ZP_00538733.1| Protozoan/cyanobacterial globin [... 98 1e-19
gi|56678184|gb|AAV94850.1| protozoan/cyanobacterial globin famil... 97 1e-19
gi|45659001|ref|YP_003087.1| putative globin [Leptospira interro... 97 2e-19
gi|42523942|ref|NP_969322.1| SEC-independent protein translocase... 96 4e-19
gi|15075602|emb|CAC47157.1| CONSERVED HYPOTHETICAL PROTEIN [Sino... 95 6e-19
gi|78698246|ref|ZP_00862749.1| similar to Truncated hemoglobins ... 95 7e-19
gi|50725383|dbj|BAD32857.1| putative 2-on-2 hemoglobin [Oryza sa... 95 8e-19
gi|74019147|ref|ZP_00689765.1| conserved hypothetical protein [B... 95 8e-19
gi|78066619|ref|YP_369388.1| globin-like protein [Burkholderia s... 95 8e-19
gi|14165165|gb|AAK55410.1| 2-on-2 hemoglobin [Hordeum vulgare] 95 9e-19
gi|78777191|ref|YP_393506.1| globin [Thiomicrospira denitrifican... 94 1e-18
gi|68189460|gb|EAN04127.1| similar to Truncated hemoglobins [Mes... 94 1e-18
gi|44888958|gb|AAS48191.1| 2-on-2 hemoglobin [Glycine max] 94 2e-18
gi|53804116|ref|YP_114018.1| protozoan/cyanobacterial globin fam... 93 2e-18
gi|67543766|ref|ZP_00421697.1| conserved hypothetical protein [B... 92 4e-18
gi|66797340|ref|ZP_00396100.1| hypothetical protein DgeoDRAFT_15... 92 5e-18
gi|27085257|gb|AAN85433.1| hemoglobin Hb2 [Triticum aestivum] 91 1e-17
gi|31559437|emb|CAD33536.1| 2-on-2 hemoglobin [Datisca glomerata] 90 2e-17
gi|67669318|ref|ZP_00466159.1| COG2346: Truncated hemoglobins [B... 90 2e-17
gi|67636465|ref|ZP_00435410.1| COG2346: Truncated hemoglobins [B... 90 2e-17
gi|56708976|ref|YP_165021.1| hypothetical protein SPOA0192 [Sili... 90 2e-17
gi|82527942|ref|ZP_00887239.1| COG2346: Truncated hemoglobins [B... 90 2e-17
gi|32261711|gb|AAP76761.1| conserved hypothetical protein [Helic... 89 3e-17
gi|71548960|ref|ZP_00669184.1| conserved hypothetical protein [N... 88 7e-17
gi|82409698|gb|ABB73807.1| possible sec-independent protein tran... 87 2e-16
gi|66798373|ref|ZP_00397127.1| similar to Truncated hemoglobins ... 87 2e-16
gi|48783812|ref|ZP_00280193.1| COG2346: Truncated hemoglobins [B... 87 2e-16
gi|79040927|ref|ZP_00872300.1| sec-independent protein transloca... 87 2e-16
gi|71549123|ref|ZP_00669330.1| possible sec-independent protein ... 87 2e-16
gi|33593122|ref|NP_880766.1| hypothetical protein BP2107 [Bordet... 87 2e-16
gi|57242253|ref|ZP_00370192.1| conserved hypothetical protein [C... 86 3e-16
gi|30249138|ref|NP_841208.1| possible sec-independent protein tr... 86 3e-16
gi|68539244|ref|ZP_00579017.1| similar to Truncated hemoglobins ... 85 4e-16
gi|78702870|ref|ZP_00867289.1| SEC-independent protein transloca... 85 5e-16
gi|13424704|gb|AAK25018.1| conserved hypothetical protein [Caulo... 84 2e-15
gi|69301286|ref|ZP_00622641.1| similar to Truncated hemoglobins ... 84 2e-15
gi|56679708|gb|AAV96374.1| conserved hypothetical protein [Silic... 83 4e-15
gi|66857090|ref|ZP_00401147.1| hypothetical protein AdehDRAFT_13... 82 6e-15
gi|78777890|ref|YP_394205.1| hypothetical protein Tmden_1693 [Th... 81 1e-14
gi|46400254|emb|CAF23703.1| conserved hypothetical protein [Para... 79 5e-14
gi|66267664|dbj|BAD98530.1| myoglobin-like protein [Pseudomonas ... 79 7e-14
gi|17934166|ref|NP_530956.1| hypothetical protein Atu0250 [Agrob... 78 1e-13
gi|15155141|gb|AAK86066.1| AGR_C_428p [Agrobacterium tumefaciens... 77 2e-13
gi|67533795|gb|EAM30551.1| Protozoan/cyanobacterial globin [Burk... 77 2e-13
gi|69937879|ref|ZP_00632465.1| sec-independent protein transloca... 75 5e-13
gi|2739247|emb|CAA05401.1| hypothetical protein [Campylobacter j... 71 1e-11
gi|67763011|ref|ZP_00501708.1| COG2346: Truncated hemoglobins [B... 70 3e-11
gi|82533471|ref|ZP_00892539.1| COG2346: Truncated hemoglobins [B... 69 4e-11
gi|41409276|ref|NP_962112.1| hypothetical protein MAP3178c [Myco... 68 1e-10
gi|77629907|ref|ZP_00792493.1| COG1018: Flavodoxin reductases (f... 67 1e-10
gi|54402090|gb|AAV34691.1| truncated hemoglobin HbO [Frankia sp.... 67 3e-10
gi|54402092|gb|AAV34692.1| truncated hemoglobin HbO [Frankia sp.... 66 3e-10
gi|54402088|gb|AAV34690.1| truncated hemoglobin HbO [Frankia sp.... 65 5e-10
gi|22125220|ref|NP_668643.1| dihydropteridine reductase [Yersini... 65 6e-10
gi|75761257|ref|ZP_00741240.1| Globin Family Protein [Bacillus t... 64 1e-09
gi|74021593|ref|ZP_00692180.1| conserved hypothetical protein [R... 58 9e-08
gi|54402086|gb|AAV34689.1| truncated hemoglobin HbO [Frankia sp.... 54 1e-06

Sequences not found previously or not previously below threshold:

gi|77958564|ref|ZP_00822595.1| COG1018: Flavodoxin reductases (f... 61 1e-08
gi|77963400|ref|ZP_00827210.1| COG1018: Flavodoxin reductases (f... 61 1e-08
gi|77974696|ref|ZP_00830235.1| COG1018: Flavodoxin reductases (f... 60 2e-08
gi|77976676|ref|ZP_00832152.1| COG1018: Flavodoxin reductases (f... 58 8e-08
gi|49612699|emb|CAG76149.1| flavohemoprotein [Erwinia carotovora... 53 3e-06
gi|59712923|ref|YP_205699.1| dihydropteridine reductase [Vibrio ... 50 2e-05
gi|82545004|ref|YP_408951.1| dihydropteridine reductase [Shigell... 49 5e-05
gi|24052976|gb|AAN44096.1| dihydropteridine reductase [Shigella ... 49 5e-05
gi|75178147|ref|ZP_00698206.1| COG1018: Flavodoxin reductases (f... 49 6e-05
gi|16130477|ref|NP_417047.1| dihydropteridine reductase, ferrisi... 49 6e-05
gi|81242075|gb|ABB62785.1| dihydropteridine reductase, ferriside... 48 6e-05
gi|479143|emb|CAA53500.1| hemoprotein X [Erwinia chrysanthemi] >... 48 6e-05
gi|74313075|ref|YP_311494.1| dihydropteridine reductase, ferrisi... 48 6e-05
gi|75196570|ref|ZP_00706640.1| COG1018: Flavodoxin reductases (f... 48 6e-05
gi|15803077|ref|NP_289108.1| dihydropteridine reductase, ferrisi... 48 6e-05
gi|26248916|ref|NP_754956.1| Flavohemoprotein [Escherichia coli ... 48 6e-05
gi|75228874|ref|ZP_00715475.1| COG1017: Hemoglobin-like flavopro... 48 6e-05
gi|75257976|ref|ZP_00729450.1| COG1018: Flavodoxin reductases (f... 48 6e-05
gi|37527172|ref|NP_930516.1| Flavohemoprotein (hemoglobin-like p... 48 7e-05
gi|28899583|ref|NP_799188.1| flavohemoprotein (flavohemoglobin) ... 48 9e-05
gi|75855424|ref|ZP_00763075.1| COG1018: Flavodoxin reductases (f... 48 1e-04
gi|48786067|ref|ZP_00282276.1| COG2346: Truncated hemoglobins [B... 47 2e-04
gi|16421102|gb|AAL21450.1| dihydropteridine reductase 2 [Salmone... 47 2e-04
gi|27364701|ref|NP_760229.1| Flavodoxin reductase [Vibrio vulnif... 47 2e-04
gi|507738|gb|AAA62190.1| Hmp 47 2e-04
gi|62181121|ref|YP_217538.1| dihydropteridine reductase 2 and ni... 47 2e-04
gi|29140834|ref|NP_804176.1| flavohemoprotein [Salmonella enteri... 47 2e-04
gi|2738912|gb|AAC24484.1| flavohemoglobin [Salmonella typhimurium] 47 2e-04
gi|56412566|ref|YP_149641.1| flavohemoprotein (haemoglobin-like ... 47 2e-04
gi|82498428|ref|ZP_00883926.1| flavohemoprotein [Shewanella sp. ... 46 3e-04
gi|78692453|ref|ZP_00856974.1| flavohemoprotein [Shewanella sp. ... 46 4e-04
gi|76791824|ref|ZP_00774328.1| Globin:Oxidoreductase FAD/NAD(P)-... 46 4e-04
gi|37681248|ref|NP_935857.1| flavodoxin reductase (ferredoxin-NA... 46 4e-04
gi|54310423|ref|YP_131443.1| putative Flavodoxin reductase [Phot... 46 5e-04
gi|75820409|ref|ZP_00750457.1| COG1018: Flavodoxin reductases (f... 45 9e-04
gi|15600953|ref|NP_232583.1| ferrisiderophore reductase [Vibrio ... 45 9e-04
gi|75825810|ref|ZP_00755246.1| COG1018: Flavodoxin reductases (f... 45 0.001
gi|75822935|ref|ZP_00752482.1| COG1018: Flavodoxin reductases (f... 45 0.001
gi|68517536|gb|EAN41190.1| Globin:Oxidoreductase FAD/NAD(P)-bind... 44 0.001
gi|49658290|emb|CAG91139.1| unnamed protein product [Debaryomyce... 44 0.001
gi|71278489|ref|YP_267597.1| flavohemoprotein [Colwellia psychre... 43 0.003
gi|78687217|ref|ZP_00851971.1| flavohemoprotein [Shewanella sp. ... 42 0.004
gi|68490250|ref|XP_711046.1| putative flavohemoglobin [Candida a... 42 0.006
gi|68490223|ref|XP_711060.1| putative flavohemoglobin [Candida a... 42 0.006
gi|68165284|gb|AAY87602.1| ferrisiderophore reductase [Vibrio ch... 42 0.007
gi|68165268|gb|AAY87594.1| ferrisiderophore reductase [Vibrio ch... 42 0.007
gi|68165272|gb|AAY87596.1| ferrisiderophore reductase [Vibrio ch... 42 0.008
gi|68165286|gb|AAY87603.1| ferrisiderophore reductase [Vibrio ch... 42 0.008
gi|77361783|ref|YP_341358.1| two-domains flavohemoprotein: one i... 40 0.023
gi|47569116|ref|ZP_00239804.1| flavohemoprotein [Bacillus cereus... 39 0.038
gi|51977369|gb|AAU18919.1| nitric oxide dioxygenase [Bacillus ce... 39 0.038
gi|42736565|gb|AAS40500.1| flavohemoprotein [Bacillus cereus ATC... 39 0.038
gi|75762469|ref|ZP_00742333.1| Flavohemoprotein / Dihydropteridi... 39 0.038
gi|49481712|ref|YP_035665.1| nitric oxide dioxygenase [Bacillus ... 39 0.038
gi|65318813|ref|ZP_00391772.1| COG1018: Flavodoxin reductases (f... 39 0.038
gi|16263102|ref|NP_435895.1| putative flavohemoglobin like prote... 38 0.069
gi|69950229|ref|ZP_00638128.1| Globin:Oxidoreductase FAD/NAD(P)-... 38 0.070
gi|30019597|ref|NP_831228.1| Nitric oxide dioxygenase [Bacillus ... 38 0.070
gi|21739948|emb|CAD38995.1| hypothetical protein [Homo sapiens] 38 0.081
gi|56420272|ref|YP_147590.1| flavohemoglobin [Geobacillus kausto... 38 0.11
gi|69934358|ref|ZP_00629436.1| Globin:Oxidoreductase FAD/NAD(P)-... 38 0.12
gi|49658303|emb|CAG91152.1| unnamed protein product [Debaryomyce... 38 0.13
gi|68490229|ref|XP_711063.1| putative flavohemoglobin [Candida a... 38 0.13
gi|46915547|emb|CAG22319.1| hypothetical protein [Photobacterium... 37 0.14
gi|71364357|ref|ZP_00654949.1| Globin:Oxidoreductase FAD/NAD(P)-... 37 0.16
gi|52695858|pdb|1TU9|A Chain A, Crystal Structure Of A Hypotheti... 37 0.18
gi|14030861|gb|AAD13810.3| paraneoplastic neuronal antigen MA1 [... 37 0.19
gi|55641029|ref|XP_510052.1| PREDICTED: paraneoplastic antigen M... 37 0.20
gi|49076996|gb|AAT49624.1| PA3967 [synthetic construct] 37 0.20
gi|66965830|ref|ZP_00413395.1| Globin:Oxidoreductase FAD/NAD(P)-... 37 0.21
gi|33089388|gb|AAP93662.1| flavohemoglobin [Sinorhizobium meliloti] 37 0.22
gi|32039132|ref|ZP_00137404.1| hypothetical protein Paer03001589... 37 0.22
gi|68053794|ref|ZP_00537959.1| chemotaxis sensory transducer [Ex... 37 0.22
gi|32417616|ref|XP_329286.1| hypothetical protein [Neurospora cr... 37 0.29
gi|10955046|ref|NP_059702.1| ophE [Agrobacterium tumefaciens] >g... 36 0.36
gi|28195138|gb|AAO33779.1| OphE [Agrobacterium tumefaciens] 36 0.36
gi|66910991|gb|AAH97291.1| Pnma1 protein [Rattus norvegicus] >gn... 36 0.48
gi|15605769|ref|NP_213146.1| flavohemoprotein [Aquifex aeolicus ... 36 0.51
gi|56962130|ref|YP_173853.1| flavohemoglobin [Bacillus clausii K... 35 0.52
gi|78488034|ref|ZP_00840286.1| probable bacterial hemoglobin [Rh... 35 0.57
gi|48146341|emb|CAG33393.1| PNMA1 [Homo sapiens] 35 0.69
gi|62512166|sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-famil... 35 0.70
gi|73964283|ref|XP_547896.2| PREDICTED: similar to Paraneoplasti... 35 0.70
gi|11993939|ref|NP_031405.1| ATP-binding cassette, sub-family A ... 35 0.70
gi|67676744|ref|ZP_00473490.1| Globin:Oxidoreductase FAD/NAD(P)-... 35 0.73
gi|50843514|ref|YP_056741.1| hypothetical protein PPA2072 [Propi... 35 0.73
gi|32447961|emb|CAD77481.1| HMP [Rhodopirellula baltica SH 1] >g... 35 0.77
gi|19554028|ref|NP_602030.1| hemoglobin-like flavoprotein [Coryn... 35 0.78
gi|52000629|sp|Q7UIY1|HMP_RHOBA Flavohemoprotein (Hemoglobin-lik... 35 0.80
gi|10173673|dbj|BAB04777.1| flavohemoglobin [Bacillus halodurans... 35 0.99
gi|58037211|ref|NP_081714.1| paraneoplastic antigen MA1 [Mus mus... 35 1.1
gi|71066001|ref|YP_264728.1| probable transcriptional regulator,... 35 1.1
gi|74205371|dbj|BAE23177.1| unnamed protein product [Mus musculu... 35 1.1
gi|42547868|gb|EAA70711.1| hypothetical protein FG00765.1 [Gibbe... 34 1.3
gi|23491538|dbj|BAC16771.1| flavohemoprotein homolog [Burkholder... 34 1.3
gi|76628386|ref|XP_582205.2| PREDICTED: similar to Paraneoplasti... 34 1.5
gi|78694013|ref|ZP_00858527.1| probable bacterial hemoglobin [Br... 34 1.6
gi|48766282|ref|ZP_00270832.1| COG0840: Methyl-accepting chemota... 34 1.6
gi|17934934|ref|NP_531724.1| methyl-accepting chemotaxis protein... 34 1.6
gi|67665880|ref|ZP_00463137.1| Globin:Oxidoreductase FAD/NAD(P)-... 34 1.6
gi|35212137|dbj|BAC89513.1| glr1572 [Gloeobacter violaceus PCC 7... 34 1.6
gi|23014982|ref|ZP_00054774.1| COG0840: Methyl-accepting chemota... 34 1.7
gi|67658233|ref|ZP_00455606.1| Globin:Oxidoreductase FAD/NAD(P)-... 34 1.7
gi|29830819|ref|NP_825453.1| putative flavohemoprotein [Streptom... 34 1.7
gi|76616065|ref|XP_606837.2| PREDICTED: similar to OG2 homeobox ... 34 1.7
gi|14590211|ref|NP_142276.1| hypothetical protein PH0287 [Pyroco... 34 1.8
gi|68213215|ref|ZP_00565049.1| Globin:Oxidoreductase FAD/NAD(P)-... 34 1.8
gi|74017095|ref|ZP_00687720.1| Globin:Oxidoreductase FAD/NAD(P)-... 34 1.8
gi|31791567|ref|NP_854060.1| PROBABLE O-SUCCINYLHOMOSERINE SULFH... 34 1.8
gi|5738846|emb|CAB52917.1| putative flavohemoprotein [Streptomyc... 34 1.9
gi|69998726|ref|ZP_00644398.1| COG1017: Hemoglobin-like flavopro... 34 1.9
gi|78065299|ref|YP_368068.1| Hemoglobin-like flavoprotein [Burkh... 34 1.9
gi|79041065|ref|ZP_00872438.1| Histidine kinase, HAMP region:Bac... 33 2.2
gi|27377918|ref|NP_769447.1| probable bacterial hemoglobin [Brad... 33 2.2
gi|67752620|ref|ZP_00491590.1| COG1018: Flavodoxin reductases (f... 33 2.2
gi|34533778|dbj|BAC86801.1| unnamed protein product [Homo sapiens] 33 2.2
gi|41327769|ref|NP_056133.2| Rho-specific guanine nucleotide exc... 33 2.3
gi|49259432|pdb|1V07|A Chain A, Crystal Structure Of Thre11val M... 33 2.3
gi|3043566|dbj|BAA25447.1| KIAA0521 protein [Homo sapiens] 33 2.4
gi|55229828|gb|AAV45247.1| heme-based aerotactic transducer HemA... 33 2.4
gi|67547629|ref|ZP_00425530.1| Globin:Oxidoreductase FAD/NAD(P)-... 33 2.4
gi|78366901|ref|ZP_00837177.1| Globin [Shewanella sp. PV-4] >gnl... 33 2.4
gi|50302221|ref|XP_451044.1| unnamed protein product [Kluyveromy... 33 2.5
gi|67686265|ref|ZP_00480021.1| COG1018: Flavodoxin reductases (f... 33 2.5
gi|3293255|gb|AAC39125.1| neural globin [Cerebratulus lacteus] >... 33 2.5
gi|52002733|gb|AAU22675.1| haem-based aerotactic transducer [Bac... 33 2.7
gi|61556945|ref|NP_001013119.1| modulator of apoptosis 1 (predic... 33 2.7
gi|50414437|gb|AAH77721.1| ARHGEF18 protein [Homo sapiens] 33 2.7
gi|6224593|emb|CAB60012.1| SPAC869.02c [Schizosaccharomyces pomb... 33 2.8
gi|67629084|ref|ZP_00428943.1| COG1018: Flavodoxin reductases (f... 33 2.9
gi|51535360|dbj|BAD37231.1| putative DNA replication licensing f... 33 3.0
gi|13786576|ref|NP_112708.1| TMP [Lactococcus lactis bacteriopha... 33 3.1
gi|67637843|ref|ZP_00436781.1| COG1018: Flavodoxin reductases (f... 33 3.2
gi|82528731|ref|ZP_00887996.1| COG1018: Flavodoxin reductases (f... 33 3.3
gi|52210862|emb|CAH36850.1| flavohemoprotein [Burkholderia pseud... 33 3.4
gi|67758237|ref|ZP_00497012.1| COG1018: Flavodoxin reductases (f... 33 3.6
gi|33286890|gb|AAH55374.1| MAP-1 protein [Mus musculus] 33 3.8
gi|11612503|ref|NP_071718.1| MAP-1 protein [Mus musculus] >gnl|B... 33 4.1
gi|74200690|dbj|BAE24735.1| unnamed protein product [Mus musculus] 33 4.3
gi|77742877|ref|ZP_00811351.1| IMP dehydrogenase/GMP reductase [... 33 4.3
gi|78688000|ref|ZP_00852729.1| hypothetical protein Shewana3DRAF... 32 4.4
gi|67158327|ref|ZP_00419318.1| Globin:Oxidoreductase FAD/NAD(P)-... 32 4.4
gi|68124225|emb|CAJ06987.1| ubiquitin-protein ligase-like, putat... 32 4.6
gi|62667529|ref|XP_219736.2| PREDICTED: similar to Paraneoplasti... 32 4.6
gi|1654421|gb|AAB17881.1| transducer HtB protein [Halobacterium ... 32 4.9
gi|15790497|ref|NP_280321.1| Htr10 [Halobacterium sp. NRC-1] >gn... 32 5.0
gi|34498943|ref|NP_903158.1| flavohemoprotein [Chromobacterium v... 32 5.1
gi|16078369|ref|NP_389187.1| flavohemoglobin [Bacillus subtilis ... 32 5.3
gi|77463802|ref|YP_353306.1| TlpL, putative cytoplasmic chemorec... 32 5.7
gi|6969003|emb|CAB73574.1| putative bacterial haemoglobin [Campy... 32 6.4
gi|68196582|gb|EAN11008.1| Glucuronate isomerase [Enterococcus f... 32 6.6
gi|41406267|ref|NP_959103.1| hypothetical protein MAP0169c [Myco... 32 7.0
gi|67526129|ref|XP_661126.1| hypothetical protein AN3522.2 [Aspe... 32 7.3
gi|15836658|ref|NP_297346.1| flavohemoprotein [Xylella fastidios... 32 7.7
gi|23346628|ref|NP_694809.1| paraneoplastic antigen MA3 [Mus mus... 32 7.7
gi|67987603|gb|EAM75394.1| regulatory protein, TetR:Tetracyclin ... 32 8.2
gi|22295715|dbj|BAC09541.1| tlr1989 [Thermosynechococcus elongat... 32 8.4
gi|29832496|ref|NP_827130.1| putative flavohemoprotein [Streptom... 32 8.4
gi|57238599|ref|YP_179730.1| flavohemoprotein, truncation [Campy... 31 9.9
gi|13421593|gb|AAK22415.1| methyl-accepting chemotaxis protein M... 31 10.0

Searching..................................................done

Results from round 5

Score E
Sequences producing significant alignments: (bits) Value
Sequences used in model and found again:

gi|10175475|dbj|BAB06573.1| BH2854 [Bacillus halodurans C-125] >... 139 4e-32
gi|74019606|ref|ZP_00690220.1| Protozoan/cyanobacterial globin [... 138 5e-32
gi|68175146|ref|ZP_00548400.1| Protozoan/cyanobacterial globin [... 135 3e-31
gi|65318572|ref|ZP_00391531.1| COG2346: Truncated hemoglobins [B... 133 2e-30
gi|30019349|ref|NP_830980.1| Globin Family Protein [Bacillus cer... 133 2e-30
gi|49477128|ref|YP_035435.1| globin family protein [Bacillus thu... 132 2e-30
gi|78067075|ref|YP_369844.1| globin-like protein [Burkholderia s... 132 2e-30
gi|67661985|ref|ZP_00459276.1| Protozoan/cyanobacterial globin [... 132 3e-30
gi|56419360|ref|YP_146678.1| hypothetical protein GK0825 [Geobac... 132 3e-30
gi|71366253|ref|ZP_00656798.1| Protozoan/cyanobacterial globin [... 132 3e-30
gi|13774099|gb|AAK38159.1| putative globin [Burkholderia pseudom... 132 4e-30
gi|72162614|ref|YP_290271.1| similar to Truncated hemoglobins [T... 131 6e-30
gi|47568403|ref|ZP_00239104.1| globin family protein [Bacillus c... 131 7e-30
gi|16078221|ref|NP_389038.1| hypothetical protein BSU11560 [Baci... 131 7e-30
gi|68232479|ref|ZP_00571626.1| Protozoan/cyanobacterial globin [... 131 8e-30
gi|76809160|ref|YP_332811.1| protozoan/cyanobacterial globin fam... 130 1e-29
gi|53725407|ref|YP_103467.1| protozoan/cyanobacterial globin fam... 130 1e-29
gi|68212276|ref|ZP_00564113.1| Protozoan/cyanobacterial globin [... 130 1e-29
gi|82410988|gb|ABB75097.1| globin family protein [Nitrosospira m... 130 1e-29
gi|20146186|dbj|BAB88980.1| hypothetical protein [Bacillus cereus] 130 1e-29
gi|76260253|ref|ZP_00767892.1| Protozoan/cyanobacterial globin [... 130 2e-29
gi|74316792|ref|YP_314532.1| putative oxygen-binding protein (gl... 130 2e-29
gi|29831913|ref|NP_826547.1| putative globin-like protein [Strep... 129 2e-29
gi|33593344|ref|NP_880988.1| globin-like protein [Bordetella per... 129 2e-29
gi|6855395|emb|CAB71209.1| putative globin [Streptomyces coelico... 129 2e-29
gi|67761460|ref|ZP_00500169.1| COG2346: Truncated hemoglobins [B... 129 2e-29
gi|68555581|ref|ZP_00594925.1| Protozoan/cyanobacterial globin [... 129 2e-29
gi|67636149|ref|ZP_00435097.1| COG2346: Truncated hemoglobins [B... 129 3e-29
gi|42524058|ref|NP_969438.1| putative globin [Bdellovibrio bacte... 129 3e-29
gi|52002870|gb|AAU22812.1| conserved protein YjbI [Bacillus lich... 129 3e-29
gi|68546393|ref|ZP_00585940.1| Protozoan/cyanobacterial globin [... 128 5e-29
gi|53803809|ref|YP_114315.1| hypothetical protein MCA1878 [Methy... 128 7e-29
gi|76801362|ref|YP_326370.1| hypothetical protein NP1422A [Natro... 127 1e-28
gi|73540638|ref|YP_295158.1| Protozoan/cyanobacterial globin [Ra... 127 1e-28
gi|68176033|ref|ZP_00549258.1| Protozoan/cyanobacterial globin [... 126 3e-28
gi|48784261|ref|ZP_00280627.1| COG2346: Truncated hemoglobins [B... 126 3e-28
gi|73536268|pdb|2BMM|A Chain A, X-Ray Structure Of A Novel Therm... 125 4e-28
gi|47573541|ref|ZP_00243579.1| COG2346: Truncated hemoglobins [R... 125 4e-28
gi|34499146|ref|NP_903361.1| probable oxygen-binding protein [Ch... 125 4e-28
gi|66967031|ref|ZP_00414580.1| Protozoan/cyanobacterial globin [... 125 5e-28
gi|74020566|ref|ZP_00691155.1| Protozoan/cyanobacterial globin [... 125 5e-28
gi|48786054|ref|ZP_00282263.1| COG2346: Truncated hemoglobins [B... 125 5e-28
gi|56964289|ref|YP_176020.1| hypothetical protein ABC2524 [Bacil... 124 9e-28
gi|68518978|gb|EAN42528.1| Protozoan/cyanobacterial globin [Shew... 123 1e-27
gi|67986909|gb|EAM74717.1| Protozoan/cyanobacterial globin [Kine... 123 1e-27
gi|82497552|ref|ZP_00883085.1| protozoan/cyanobacterial globin f... 123 1e-27
gi|71907626|ref|YP_285213.1| Protozoan/cyanobacterial globin [De... 123 2e-27
gi|121274|sp|P17724|GLB_TETPY Myoglobin (Hemoglobin) >gnl|BL_ORD... 122 3e-27
gi|50954582|ref|YP_061870.1| globin-like protein [Leifsonia xyli... 122 3e-27
gi|23098673|ref|NP_692139.1| hypothetical protein OB1218 [Oceano... 122 3e-27
gi|7322057|gb|AAA29446.2| hemoglobin major component [Paramecium... 122 4e-27
gi|4883447|emb|CAB43160.1| putative globin [Mycobacterium leprae] 122 5e-27
gi|53803300|ref|YP_114918.1| cyanobacterial globin family protei... 122 5e-27
gi|15827640|ref|NP_301903.1| hemoglobin-like, oxygen carrier [My... 121 5e-27
gi|17429109|emb|CAD15797.1| PUTATIVE OXYGEN-BINDING PROTEIN (GLO... 121 6e-27
gi|67670776|ref|ZP_00467575.1| COG2346: Truncated hemoglobins [B... 121 6e-27
gi|67542904|ref|ZP_00420838.1| Protozoan/cyanobacterial globin [... 121 6e-27
gi|38234371|ref|NP_940138.1| Putative hemoglobin [Corynebacteriu... 121 6e-27
gi|54023281|ref|YP_117523.1| putative globin [Nocardia farcinica... 121 7e-27
gi|78696276|ref|ZP_00860786.1| conserved hypothetical protein [B... 121 7e-27
gi|47169309|pdb|1UVY|A Chain A, Heme-Ligand Tunneling In Group I... 121 9e-27
gi|31792728|ref|NP_855221.1| Probable hemoglobin glbN [Mycobacte... 120 1e-26
gi|415308|dbj|BAA02300.1| B-type of major hemoglobin component [... 120 2e-26
gi|19553644|ref|NP_601646.1| hemoglobin-like protein [Corynebact... 120 2e-26
gi|67158617|ref|ZP_00419523.1| Protozoan/cyanobacterial globin [... 120 2e-26
gi|1384087|dbj|BAA08540.1| hemoglobin [Paramecium jenningsi] >gn... 120 2e-26
gi|41408389|ref|NP_961225.1| GlbO [Mycobacterium avium subsp. pa... 120 2e-26
gi|55232083|gb|AAV47502.1| cyanoglobin [Haloarcula marismortui A... 120 2e-26
gi|31793651|ref|NP_856144.1| POSSIBLE GLOBIN (OXYGEN-BINDING PRO... 120 2e-26
gi|74830134|emb|CAI39012.1| globin, putative [Paramecium tetraur... 119 2e-26
gi|74830140|emb|CAI39013.1| globin, putative [Paramecium tetraur... 119 2e-26
gi|1384085|dbj|BAA08538.1| hemoglobin [Paramecium multimicronucl... 119 2e-26
gi|76783772|ref|ZP_00770962.1| COG2346: Truncated hemoglobins [M... 119 3e-26
gi|68228966|ref|ZP_00568165.1| Protozoan/cyanobacterial globin [... 119 3e-26
gi|74830192|emb|CAI39023.1| globin, putative [Paramecium tetraur... 118 4e-26
gi|66797407|ref|ZP_00396166.1| Protozoan/cyanobacterial globin [... 118 4e-26
gi|78690217|ref|ZP_00854867.1| conserved hypothetical globin [Sh... 118 4e-26
gi|15157551|gb|AAK88117.1| AGR_C_4317p [Agrobacterium tumefacien... 118 5e-26
gi|71737447|ref|YP_276073.1| protozoan/cyanobacterial globin fam... 118 5e-26
gi|28871348|ref|NP_793967.1| protozoan/cyanobacterial globin fam... 117 8e-26
gi|78687608|ref|ZP_00852352.1| conserved hypothetical globin [Sh... 117 9e-26
gi|77814739|ref|ZP_00813993.1| Protozoan/cyanobacterial globin [... 117 9e-26
gi|27376186|ref|NP_767715.1| hypothetical protein bll1075 [Brady... 117 9e-26
gi|17936262|ref|NP_533052.1| hypothetical protein Atu2380 [Agrob... 117 1e-25
gi|437983|emb|CAA51421.1| Li637 [Chlamydomonas eugametos] >gnl|B... 117 1e-25
gi|82497762|ref|ZP_00883290.1| conserved hypothetical globin [Sh... 117 1e-25
gi|74830120|emb|CAI39009.1| globin, putative [Paramecium tetraur... 117 1e-25
gi|15075442|emb|CAC46998.1| CONSERVED HYPOTHETICAL PROTEIN [Sino... 117 1e-25
gi|68548528|ref|ZP_00588023.1| Protozoan/cyanobacterial globin [... 117 2e-25
gi|71063020|gb|AAZ22023.1| Bacterial-like globin [Candidatus Pel... 116 2e-25
gi|23494188|dbj|BAC19155.1| putative globin [Corynebacterium eff... 116 2e-25
gi|77359423|ref|YP_338998.1| putative protozoan/cyanobacterial g... 116 2e-25
gi|69156976|gb|EAN69248.1| Protozoan/cyanobacterial globin [Shew... 116 2e-25
gi|417052|sp|Q03459|GLB_TETTH Myoglobin (Hemoglobin) >gnl|BL_ORD... 116 2e-25
gi|78366957|ref|ZP_00837232.1| Protozoan/cyanobacterial globin [... 116 3e-25
gi|47169308|pdb|1UVX|A Chain A, Heme-Ligand Tunneling On Group I... 116 3e-25
gi|41407351|ref|NP_960187.1| GlbN [Mycobacterium avium subsp. pa... 116 3e-25
gi|69951378|ref|ZP_00639119.1| Protozoan/cyanobacterial globin [... 116 3e-25
gi|68519313|gb|EAN42852.1| Protozoan/cyanobacterial globin [Shew... 115 3e-25
gi|24371639|ref|NP_715681.1| hypothetical globin [Shewanella one... 115 3e-25
gi|69953395|ref|ZP_00640540.1| Protozoan/cyanobacterial globin [... 115 5e-25
gi|12248875|dbj|BAB20310.1| hemoglobin [Paramecium caudatum] >gn... 114 7e-25
gi|74830227|emb|CAI39030.1| globin, putative [Paramecium tetraur... 114 7e-25
gi|1100220|gb|AAB41122.1| cyanoglobin [Nostoc sp.] >gnl|BL_ORD_I... 114 8e-25
gi|76792214|ref|ZP_00774715.1| Protozoan/cyanobacterial globin [... 114 9e-25
gi|69159912|gb|EAN72013.1| protozoan/cyanobacterial globin famil... 113 1e-24
gi|66047167|ref|YP_237008.1| Protozoan/cyanobacterial globin [Ps... 113 1e-24
gi|21231965|ref|NP_637882.1| cyanoglobin [Xanthomonas campestris... 113 1e-24
gi|23130505|ref|ZP_00112318.1| COG2346: Truncated hemoglobins [N... 113 1e-24
gi|437981|emb|CAA51420.1| Li410p [Chlamydomonas eugametos] >gnl|... 113 1e-24
gi|15806025|ref|NP_294726.1| hypothetical protein DR1002 [Deinoc... 113 2e-24
gi|68447680|dbj|BAE05264.1| unnamed protein product [Staphylococ... 112 3e-24
gi|57168601|ref|ZP_00367734.1| conserved hypothetical protein [C... 112 3e-24
gi|57866545|ref|YP_188173.1| protozoan/cyanobacterial globin fam... 112 3e-24
gi|67847992|ref|ZP_00503110.1| Protozoan/cyanobacterial globin [... 112 4e-24
gi|75674939|ref|YP_317360.1| hypothetical protein Nwi_0742 [Nitr... 112 4e-24
gi|21243436|ref|NP_643018.1| cyanoglobin [Xanthomonas axonopodis... 112 5e-24
gi|78048414|ref|YP_364589.1| Globin [Xanthomonas campestris pv. ... 111 6e-24
gi|77359012|ref|YP_338587.1| putative hemoglobin-like oxygen-bin... 111 7e-24
gi|62423976|ref|ZP_00379129.1| COG2346: Truncated hemoglobins [B... 111 9e-24
gi|67929246|ref|ZP_00522429.1| Protozoan/cyanobacterial globin:A... 110 1e-23
gi|47575085|ref|ZP_00245120.1| COG2346: Truncated hemoglobins [R... 110 1e-23
gi|48425378|pdb|1RTX|A Chain A, Crystal Structure Of Synechocyst... 110 1e-23
gi|54298537|ref|YP_124906.1| hypothetical protein lpp2601 [Legio... 110 1e-23
gi|54309529|ref|YP_130549.1| hypothetical protein PBPRA2362 [Pho... 110 1e-23
gi|68263209|emb|CAI36697.1| hemoglobin-like protein [Corynebacte... 110 1e-23
gi|58427457|gb|AAW76494.1| cyanoglobin [Xanthomonas oryzae pv. o... 110 1e-23
gi|16330583|ref|NP_441311.1| cyanoglobin [Synechocystis sp. PCC ... 110 2e-23
gi|27467610|ref|NP_764247.1| hypothetical protein SE0692 [Staphy... 110 2e-23
gi|52842743|ref|YP_096542.1| myoglobin-like [Legionella pneumoph... 110 2e-23
gi|56460041|ref|YP_155322.1| Cyanoglobin family protein [Idiomar... 109 2e-23
gi|232163|sp|Q00812|GLBN_NOSCO Cyanoglobin >gnl|BL_ORD_ID|146868... 109 3e-23
gi|79043629|ref|ZP_00874113.1| Protozoan/cyanobacterial globin [... 109 3e-23
gi|67859863|gb|EAM54924.1| Protozoan/cyanobacterial globin [Soli... 108 4e-23
gi|67676504|ref|ZP_00473252.1| Protozoan/cyanobacterial globin [... 108 4e-23
gi|69929809|ref|ZP_00626686.1| conserved hypothetical protein [N... 107 9e-23
gi|49244221|emb|CAG42647.1| protozoan/cyanobacterial globin fami... 107 9e-23
gi|49483165|ref|YP_040389.1| protozoan/cyanobacterial globin fam... 107 9e-23
gi|78696782|ref|ZP_00861291.1| probable oxygen-binding protein [... 107 1e-22
gi|73663091|ref|YP_301872.1| putative hemoglobin-like protein [S... 107 1e-22
gi|54295372|ref|YP_127787.1| hypothetical protein lpl2457 [Legio... 107 1e-22
gi|48854100|ref|ZP_00308264.1| COG2346: Truncated hemoglobins [C... 107 2e-22
gi|6967936|emb|CAB75103.1| hypothetical protein Cj0465c [Campylo... 107 2e-22
gi|57284381|gb|AAW36475.1| protozoan/cyanobacterial globin famil... 106 2e-22
gi|13470534|ref|NP_102102.1| hypothetical protein mlr0267 [Mesor... 106 2e-22
gi|48861281|ref|ZP_00315184.1| COG2346: Truncated hemoglobins [M... 106 3e-22
gi|57237519|ref|YP_178533.1| hypothetical protein CJE0515 [Campy... 105 5e-22
gi|79039300|ref|ZP_00871006.1| similar to Truncated hemoglobins ... 104 1e-21
gi|74023464|ref|ZP_00694036.1| hypothetical protein RferDRAFT_08... 103 1e-21
gi|57240682|ref|ZP_00368630.1| conserved hypothetical protein [C... 103 2e-21
gi|32445985|emb|CAD78716.1| hemoglobin-like protein HbN [Rhodopi... 102 3e-21
gi|18766961|gb|AAL79195.1| cyanoglobin [Synechococcus sp. PCC 7002] 102 5e-21
gi|39935786|ref|NP_948062.1| hypothetical protein RPA2719 [Rhodo... 101 6e-21
gi|17984557|gb|AAL53640.1| SEC-INDEPENDENT PROTEIN TRANSLOCASE P... 101 7e-21
gi|27381333|ref|NP_772862.1| probable Sec-independent protein tr... 100 1e-20
gi|23464267|gb|AAN34070.1| conserved hypothetical protein [Bruce... 100 1e-20
gi|62317274|ref|YP_223127.1| hypothetical protein BruAb2_0335 [B... 100 1e-20
gi|78490029|ref|ZP_00842279.1| conserved hypothetical protein [R... 100 2e-20
gi|77361140|ref|YP_340715.1| conserved protein of unknown functi... 100 2e-20
gi|56678184|gb|AAV94850.1| protozoan/cyanobacterial globin famil... 99 3e-20
gi|15075602|emb|CAC47157.1| CONSERVED HYPOTHETICAL PROTEIN [Sino... 99 4e-20
gi|24216675|ref|NP_714156.1| putative globin-like protein [Lepto... 99 4e-20
gi|48862691|ref|ZP_00316586.1| COG2346: Truncated hemoglobins [M... 99 4e-20
gi|42523942|ref|NP_969322.1| SEC-independent protein translocase... 99 4e-20
gi|68229245|ref|ZP_00568442.1| conserved hypothetical protein [F... 99 4e-20
gi|14165163|gb|AAK55409.1| 2-on-2 hemoglobin [Arabidopsis thaliana] 98 1e-19
gi|18418064|ref|NP_567901.1| GLB3 [Arabidopsis thaliana] >gnl|BL... 97 2e-19
gi|68189460|gb|EAN04127.1| similar to Truncated hemoglobins [Mes... 97 2e-19
gi|68054576|ref|ZP_00538733.1| Protozoan/cyanobacterial globin [... 97 2e-19
gi|29829858|ref|NP_824492.1| hypothetical protein SAV3316 [Strep... 96 3e-19
gi|74019147|ref|ZP_00689765.1| conserved hypothetical protein [B... 96 3e-19
gi|7270173|emb|CAB79986.1| putative protein [Arabidopsis thalian... 96 3e-19
gi|78698246|ref|ZP_00862749.1| similar to Truncated hemoglobins ... 96 3e-19
gi|78066619|ref|YP_369388.1| globin-like protein [Burkholderia s... 96 3e-19
gi|45659001|ref|YP_003087.1| putative globin [Leptospira interro... 95 6e-19
gi|14165165|gb|AAK55410.1| 2-on-2 hemoglobin [Hordeum vulgare] 94 1e-18
gi|77629907|ref|ZP_00792493.1| COG1018: Flavodoxin reductases (f... 94 1e-18
gi|23126739|ref|ZP_00108627.1| COG2346: Truncated hemoglobins [N... 94 1e-18
gi|67543766|ref|ZP_00421697.1| conserved hypothetical protein [B... 94 2e-18
gi|78777191|ref|YP_393506.1| globin [Thiomicrospira denitrifican... 93 2e-18
gi|50725383|dbj|BAD32857.1| putative 2-on-2 hemoglobin [Oryza sa... 93 3e-18
gi|22125220|ref|NP_668643.1| dihydropteridine reductase [Yersini... 93 3e-18
gi|66797340|ref|ZP_00396100.1| hypothetical protein DgeoDRAFT_15... 92 4e-18
gi|44888958|gb|AAS48191.1| 2-on-2 hemoglobin [Glycine max] 92 4e-18
gi|53804116|ref|YP_114018.1| protozoan/cyanobacterial globin fam... 92 6e-18
gi|77958564|ref|ZP_00822595.1| COG1018: Flavodoxin reductases (f... 91 9e-18
gi|32261711|gb|AAP76761.1| conserved hypothetical protein [Helic... 91 1e-17
gi|77963400|ref|ZP_00827210.1| COG1018: Flavodoxin reductases (f... 91 1e-17
gi|67669318|ref|ZP_00466159.1| COG2346: Truncated hemoglobins [B... 91 1e-17
gi|67636465|ref|ZP_00435410.1| COG2346: Truncated hemoglobins [B... 91 1e-17
gi|82527942|ref|ZP_00887239.1| COG2346: Truncated hemoglobins [B... 90 1e-17
gi|27085257|gb|AAN85433.1| hemoglobin Hb2 [Triticum aestivum] 90 2e-17
gi|57242253|ref|ZP_00370192.1| conserved hypothetical protein [C... 90 2e-17
gi|56708976|ref|YP_165021.1| hypothetical protein SPOA0192 [Sili... 90 2e-17
gi|79040927|ref|ZP_00872300.1| sec-independent protein transloca... 90 2e-17
gi|77974696|ref|ZP_00830235.1| COG1018: Flavodoxin reductases (f... 90 2e-17
gi|31559437|emb|CAD33536.1| 2-on-2 hemoglobin [Datisca glomerata] 90 2e-17
gi|13424704|gb|AAK25018.1| conserved hypothetical protein [Caulo... 90 3e-17
gi|71548960|ref|ZP_00669184.1| conserved hypothetical protein [N... 89 4e-17
gi|77976676|ref|ZP_00832152.1| COG1018: Flavodoxin reductases (f... 89 6e-17
gi|78702870|ref|ZP_00867289.1| SEC-independent protein transloca... 89 6e-17
gi|59712923|ref|YP_205699.1| dihydropteridine reductase [Vibrio ... 88 8e-17
gi|33593122|ref|NP_880766.1| hypothetical protein BP2107 [Bordet... 87 1e-16
gi|68539244|ref|ZP_00579017.1| similar to Truncated hemoglobins ... 87 1e-16
gi|48783812|ref|ZP_00280193.1| COG2346: Truncated hemoglobins [B... 87 2e-16
gi|71549123|ref|ZP_00669330.1| possible sec-independent protein ... 86 3e-16
gi|82409698|gb|ABB73807.1| possible sec-independent protein tran... 86 3e-16
gi|82545004|ref|YP_408951.1| dihydropteridine reductase [Shigell... 86 3e-16
gi|49612699|emb|CAG76149.1| flavohemoprotein [Erwinia carotovora... 86 4e-16
gi|66798373|ref|ZP_00397127.1| similar to Truncated hemoglobins ... 86 4e-16
gi|24052976|gb|AAN44096.1| dihydropteridine reductase [Shigella ... 85 4e-16
gi|75178147|ref|ZP_00698206.1| COG1018: Flavodoxin reductases (f... 85 5e-16
gi|16130477|ref|NP_417047.1| dihydropteridine reductase, ferrisi... 85 5e-16
gi|75228874|ref|ZP_00715475.1| COG1017: Hemoglobin-like flavopro... 85 5e-16
gi|81242075|gb|ABB62785.1| dihydropteridine reductase, ferriside... 85 5e-16
gi|15803077|ref|NP_289108.1| dihydropteridine reductase, ferrisi... 85 6e-16
gi|75196570|ref|ZP_00706640.1| COG1018: Flavodoxin reductases (f... 85 6e-16
gi|74313075|ref|YP_311494.1| dihydropteridine reductase, ferrisi... 85 6e-16
gi|26248916|ref|NP_754956.1| Flavohemoprotein [Escherichia coli ... 85 6e-16
gi|75257976|ref|ZP_00729450.1| COG1018: Flavodoxin reductases (f... 85 6e-16
gi|30249138|ref|NP_841208.1| possible sec-independent protein tr... 85 6e-16
gi|78777890|ref|YP_394205.1| hypothetical protein Tmden_1693 [Th... 84 1e-15
gi|69301286|ref|ZP_00622641.1| similar to Truncated hemoglobins ... 84 1e-15
gi|28899583|ref|NP_799188.1| flavohemoprotein (flavohemoglobin) ... 84 2e-15
gi|75855424|ref|ZP_00763075.1| COG1018: Flavodoxin reductases (f... 84 2e-15
gi|27364701|ref|NP_760229.1| Flavodoxin reductase [Vibrio vulnif... 83 3e-15
gi|37527172|ref|NP_930516.1| Flavohemoprotein (hemoglobin-like p... 82 4e-15
gi|54310423|ref|YP_131443.1| putative Flavodoxin reductase [Phot... 82 4e-15
gi|56679708|gb|AAV96374.1| conserved hypothetical protein [Silic... 82 4e-15
gi|37681248|ref|NP_935857.1| flavodoxin reductase (ferredoxin-NA... 82 6e-15
gi|16421102|gb|AAL21450.1| dihydropteridine reductase 2 [Salmone... 82 7e-15
gi|17934166|ref|NP_530956.1| hypothetical protein Atu0250 [Agrob... 82 7e-15
gi|507738|gb|AAA62190.1| Hmp 82 7e-15
gi|62181121|ref|YP_217538.1| dihydropteridine reductase 2 and ni... 82 7e-15
gi|29140834|ref|NP_804176.1| flavohemoprotein [Salmonella enteri... 82 8e-15
gi|2738912|gb|AAC24484.1| flavohemoglobin [Salmonella typhimurium] 82 8e-15
gi|56412566|ref|YP_149641.1| flavohemoprotein (haemoglobin-like ... 82 8e-15
gi|479143|emb|CAA53500.1| hemoprotein X [Erwinia chrysanthemi] >... 81 1e-14
gi|15155141|gb|AAK86066.1| AGR_C_428p [Agrobacterium tumefaciens... 81 1e-14
gi|46400254|emb|CAF23703.1| conserved hypothetical protein [Para... 81 1e-14
gi|66857090|ref|ZP_00401147.1| hypothetical protein AdehDRAFT_13... 78 8e-14
gi|67533795|gb|EAM30551.1| Protozoan/cyanobacterial globin [Burk... 77 2e-13
gi|69937879|ref|ZP_00632465.1| sec-independent protein transloca... 77 2e-13
gi|82498428|ref|ZP_00883926.1| flavohemoprotein [Shewanella sp. ... 75 8e-13
gi|78692453|ref|ZP_00856974.1| flavohemoprotein [Shewanella sp. ... 75 9e-13
gi|66267664|dbj|BAD98530.1| myoglobin-like protein [Pseudomonas ... 74 1e-12
gi|75820409|ref|ZP_00750457.1| COG1018: Flavodoxin reductases (f... 74 1e-12
gi|15600953|ref|NP_232583.1| ferrisiderophore reductase [Vibrio ... 74 1e-12
gi|75825810|ref|ZP_00755246.1| COG1018: Flavodoxin reductases (f... 74 2e-12
gi|75822935|ref|ZP_00752482.1| COG1018: Flavodoxin reductases (f... 74 2e-12
gi|76791824|ref|ZP_00774328.1| Globin:Oxidoreductase FAD/NAD(P)-... 73 2e-12
gi|68517536|gb|EAN41190.1| Globin:Oxidoreductase FAD/NAD(P)-bind... 72 8e-12
gi|2739247|emb|CAA05401.1| hypothetical protein [Campylobacter j... 71 9e-12
gi|67763011|ref|ZP_00501708.1| COG2346: Truncated hemoglobins [B... 70 2e-11
gi|82533471|ref|ZP_00892539.1| COG2346: Truncated hemoglobins [B... 70 3e-11
gi|48786067|ref|ZP_00282276.1| COG2346: Truncated hemoglobins [B... 69 7e-11
gi|41409276|ref|NP_962112.1| hypothetical protein MAP3178c [Myco... 68 9e-11
gi|54402090|gb|AAV34691.1| truncated hemoglobin HbO [Frankia sp.... 66 3e-10
gi|49658290|emb|CAG91139.1| unnamed protein product [Debaryomyce... 66 4e-10
gi|54402092|gb|AAV34692.1| truncated hemoglobin HbO [Frankia sp.... 65 5e-10
gi|54402088|gb|AAV34690.1| truncated hemoglobin HbO [Frankia sp.... 64 2e-09
gi|75761257|ref|ZP_00741240.1| Globin Family Protein [Bacillus t... 62 6e-09
gi|74021593|ref|ZP_00692180.1| conserved hypothetical protein [R... 58 9e-08
gi|54402086|gb|AAV34689.1| truncated hemoglobin HbO [Frankia sp.... 54 2e-06

Sequences not found previously or not previously below threshold:

gi|78687217|ref|ZP_00851971.1| flavohemoprotein [Shewanella sp. ... 72 8e-12
gi|68165284|gb|AAY87602.1| ferrisiderophore reductase [Vibrio ch... 70 2e-11
gi|71278489|ref|YP_267597.1| flavohemoprotein [Colwellia psychre... 70 2e-11
gi|68165268|gb|AAY87594.1| ferrisiderophore reductase [Vibrio ch... 70 2e-11
gi|68165272|gb|AAY87596.1| ferrisiderophore reductase [Vibrio ch... 70 2e-11
gi|68165286|gb|AAY87603.1| ferrisiderophore reductase [Vibrio ch... 70 2e-11
gi|77361783|ref|YP_341358.1| two-domains flavohemoprotein: one i... 60 1e-08
gi|16263102|ref|NP_435895.1| putative flavohemoglobin like prote... 59 7e-08
gi|68490250|ref|XP_711046.1| putative flavohemoglobin [Candida a... 58 7e-08
gi|68490223|ref|XP_711060.1| putative flavohemoglobin [Candida a... 58 7e-08
gi|47569116|ref|ZP_00239804.1| flavohemoprotein [Bacillus cereus... 57 2e-07
gi|51977369|gb|AAU18919.1| nitric oxide dioxygenase [Bacillus ce... 57 2e-07
gi|75762469|ref|ZP_00742333.1| Flavohemoprotein / Dihydropteridi... 57 2e-07
gi|65318813|ref|ZP_00391772.1| COG1018: Flavodoxin reductases (f... 57 2e-07
gi|49481712|ref|YP_035665.1| nitric oxide dioxygenase [Bacillus ... 57 2e-07
gi|42736565|gb|AAS40500.1| flavohemoprotein [Bacillus cereus ATC... 57 2e-07
gi|69950229|ref|ZP_00638128.1| Globin:Oxidoreductase FAD/NAD(P)-... 57 2e-07
gi|33089388|gb|AAP93662.1| flavohemoglobin [Sinorhizobium meliloti] 57 2e-07
gi|56962130|ref|YP_173853.1| flavohemoglobin [Bacillus clausii K... 57 2e-07
gi|30019597|ref|NP_831228.1| Nitric oxide dioxygenase [Bacillus ... 57 2e-07
gi|49658303|emb|CAG91152.1| unnamed protein product [Debaryomyce... 56 3e-07
gi|71364357|ref|ZP_00654949.1| Globin:Oxidoreductase FAD/NAD(P)-... 56 4e-07
gi|52002629|gb|AAU22571.1| flavohemoglobin [Bacillus licheniform... 55 6e-07
gi|10173673|dbj|BAB04777.1| flavohemoglobin [Bacillus halodurans... 55 6e-07
gi|3551511|dbj|BAA33011.1| flavohemoglobin [Fusarium oxysporum] 54 1e-06
gi|67542011|ref|XP_664773.1| hypothetical protein AN7169.2 [Aspe... 54 1e-06
gi|42550399|gb|EAA73242.1| hypothetical protein FG04458.1 [Gibbe... 53 3e-06
gi|32447961|emb|CAD77481.1| HMP [Rhodopirellula baltica SH 1] >g... 53 3e-06
gi|69998726|ref|ZP_00644398.1| COG1017: Hemoglobin-like flavopro... 53 3e-06
gi|74017095|ref|ZP_00687720.1| Globin:Oxidoreductase FAD/NAD(P)-... 53 3e-06
gi|78065299|ref|YP_368068.1| Hemoglobin-like flavoprotein [Burkh... 53 4e-06
gi|52000629|sp|Q7UIY1|HMP_RHOBA Flavohemoprotein (Hemoglobin-lik... 53 4e-06
gi|56420272|ref|YP_147590.1| flavohemoglobin [Geobacillus kausto... 53 4e-06
gi|67547629|ref|ZP_00425530.1| Globin:Oxidoreductase FAD/NAD(P)-... 53 4e-06
gi|68490229|ref|XP_711063.1| putative flavohemoglobin [Candida a... 52 4e-06
gi|67629084|ref|ZP_00428943.1| COG1018: Flavodoxin reductases (f... 52 5e-06
gi|82528731|ref|ZP_00887996.1| COG1018: Flavodoxin reductases (f... 52 7e-06
gi|67637843|ref|ZP_00436781.1| COG1018: Flavodoxin reductases (f... 52 7e-06
gi|52210862|emb|CAH36850.1| flavohemoprotein [Burkholderia pseud... 52 8e-06
gi|69934358|ref|ZP_00629436.1| Globin:Oxidoreductase FAD/NAD(P)-... 52 8e-06
gi|67758237|ref|ZP_00497012.1| COG1018: Flavodoxin reductases (f... 52 8e-06
gi|67158327|ref|ZP_00419318.1| Globin:Oxidoreductase FAD/NAD(P)-... 51 1e-05
gi|71736900|ref|YP_273509.1| flavohemoprotein [Pseudomonas syrin... 51 1e-05
gi|34498943|ref|NP_903158.1| flavohemoprotein [Chromobacterium v... 51 1e-05
gi|67665880|ref|ZP_00463137.1| Globin:Oxidoreductase FAD/NAD(P)-... 51 1e-05
gi|67658233|ref|ZP_00455606.1| Globin:Oxidoreductase FAD/NAD(P)-... 51 1e-05
gi|67752620|ref|ZP_00491590.1| COG1018: Flavodoxin reductases (f... 51 1e-05
gi|67686265|ref|ZP_00480021.1| COG1018: Flavodoxin reductases (f... 50 2e-05
gi|32417616|ref|XP_329286.1| hypothetical protein [Neurospora cr... 50 2e-05
gi|42547868|gb|EAA70711.1| hypothetical protein FG00765.1 [Gibbe... 50 2e-05
gi|67526129|ref|XP_661126.1| hypothetical protein AN3522.2 [Aspe... 50 3e-05
gi|68213215|ref|ZP_00565049.1| Globin:Oxidoreductase FAD/NAD(P)-... 49 4e-05
gi|66845036|gb|EAL85372.1| flavohemoprotein [Aspergillus fumigat... 49 5e-05
gi|16078369|ref|NP_389187.1| flavohemoglobin [Bacillus subtilis ... 49 5e-05
gi|66965830|ref|ZP_00413395.1| Globin:Oxidoreductase FAD/NAD(P)-... 49 6e-05
gi|74318347|ref|YP_316087.1| flavohemoglobin [Thiobacillus denit... 48 1e-04
gi|58039327|ref|YP_191291.1| Flavohemoprotein [Gluconobacter oxy... 48 1e-04
gi|23491538|dbj|BAC16771.1| flavohemoprotein homolog [Burkholder... 48 1e-04
gi|60417040|emb|CAF32307.1| putative haemoglobin [Aspergillus or... 47 1e-04
gi|38637864|ref|NP_942838.1| flavohemoprotein [Cupriavidus necat... 47 1e-04
gi|460999|emb|CAA52381.1| flavohemoprotein [Wautersia eutropha] ... 47 1e-04
gi|19554028|ref|NP_602030.1| hemoglobin-like flavoprotein [Coryn... 47 1e-04
gi|71064546|ref|XP_766859.1| flavohemoprotein [Giardia lamblia A... 47 2e-04
gi|23097746|ref|NP_691212.1| flavohemoglobin [Oceanobacillus ihe... 47 2e-04
gi|15605769|ref|NP_213146.1| flavohemoprotein [Aquifex aeolicus ... 47 2e-04
gi|57226076|gb|AAW42537.1| response to stress-related protein, p... 47 2e-04
gi|50788082|emb|CAE17673.1| putative flavohaemoglobin [Aspergill... 47 2e-04
gi|66844151|gb|EAL84490.1| flavohemoprotein [Aspergillus fumigat... 47 2e-04
gi|67909697|ref|ZP_00508092.1| Globin:Oxidoreductase FAD/NAD(P)-... 47 3e-04
gi|37783289|gb|AAP41066.1| flavohemoglobin [Cryptococcus neoform... 47 3e-04
gi|51013379|gb|AAT92983.1| YGR234W [Saccharomyces cerevisiae] >g... 46 3e-04
gi|729488|sp|P39676|FHP_YEAST Flavohemoprotein (Hemoglobin-like ... 46 3e-04
gi|18145617|dbj|BAB81659.1| bacterial hemoglobin [Clostridium pe... 46 4e-04
gi|67676744|ref|ZP_00473490.1| Globin:Oxidoreductase FAD/NAD(P)-... 46 4e-04
gi|6969003|emb|CAB73574.1| putative bacterial haemoglobin [Campy... 46 5e-04
gi|39975311|ref|XP_369046.1| hypothetical protein MG00198.4 [Mag... 45 6e-04
gi|57238599|ref|YP_179730.1| flavohemoprotein, truncation [Campy... 45 7e-04
gi|50549235|ref|XP_502088.1| hypothetical protein [Yarrowia lipo... 45 8e-04
gi|6224593|emb|CAB60012.1| SPAC869.02c [Schizosaccharomyces pomb... 45 8e-04
gi|29832496|ref|NP_827130.1| putative flavohemoprotein [Streptom... 45 9e-04
gi|66801393|ref|XP_629622.1| flavohemoglobin [Dictyostelium disc... 45 0.001
gi|33596273|ref|NP_883916.1| flavohemoprotein [Bordetella parape... 45 0.001
gi|58864970|emb|CAF25490.1| flavohemoglobin [Aspergillus niger] 45 0.001
gi|60417044|emb|CAF32309.1| truncated flavohaemoglobin [Aspergil... 44 0.001
gi|26987544|ref|NP_742969.1| flavohemoprotein [Pseudomonas putid... 44 0.001
gi|7688310|emb|CAB89766.1| flavohemoprotein [Streptomyces coelic... 44 0.001
gi|54632971|emb|CAD55817.1| flavohemoglobin [Pseudomonas stutzeri] 44 0.001
gi|5821410|dbj|BAA83811.1| flavohemoglobin [Dictyostelium discoi... 44 0.001
gi|66801395|ref|XP_629623.1| flavohemoglobin [Dictyostelium disc... 44 0.001
gi|57168309|ref|ZP_00367443.1| flavohemoprotein [Campylobacter c... 44 0.002
gi|15836658|ref|NP_297346.1| flavohemoprotein [Xylella fastidios... 44 0.002
gi|49088606|gb|AAT51588.1| PA2664 [synthetic construct] 44 0.002
gi|9948735|gb|AAG06052.1| flavohemoprotein [Pseudomonas aerugino... 43 0.002
gi|46163761|ref|ZP_00135974.2| COG1018: Flavodoxin reductases (f... 43 0.002
gi|73663719|ref|YP_302500.1| flavohemoprotein [Staphylococcus sa... 43 0.002
gi|70732363|ref|YP_262119.1| flavohemoprotein [Pseudomonas fluor... 43 0.002
gi|33593213|ref|NP_880857.1| flavohemoprotein [Bordetella pertus... 43 0.002
gi|78488034|ref|ZP_00840286.1| probable bacterial hemoglobin [Rh... 43 0.002
gi|67543014|ref|ZP_00420948.1| Globin:Oxidoreductase FAD/NAD(P)-... 43 0.003
gi|50086221|ref|YP_047731.1| putative flavohemoprotein (Hemoglob... 43 0.003
gi|17430422|emb|CAD16895.1| PROBABLE FLAVOHEMOPROTEIN (HEMOGLOBI... 43 0.003
gi|50293309|ref|XP_449066.1| unnamed protein product [Candida gl... 43 0.003
gi|60417042|emb|CAF32308.1| putative haemoglobin [Aspergillus ni... 43 0.004
gi|28197982|ref|NP_778296.1| flavohemoprotein [Xylella fastidios... 43 0.004
gi|71900750|ref|ZP_00682871.1| Globin:Oxidoreductase FAD/NAD(P)-... 43 0.004
gi|73663037|ref|YP_301818.1| putative flavohemoprotein [Staphylo... 42 0.005
gi|57241724|ref|ZP_00369669.1| flavohemoprotein [Campylobacter l... 42 0.005
gi|77460873|ref|YP_350380.1| Oxidoreductase FAD-binding region [... 42 0.006
gi|32527608|gb|AAP86201.1| single-domain hemoglobin [Campylobact... 42 0.006
gi|46915547|emb|CAG22319.1| hypothetical protein [Photobacterium... 42 0.007
gi|68554467|ref|ZP_00593812.1| Globin:Oxidoreductase FAD/NAD(P)-... 42 0.008
gi|48787229|ref|ZP_00283311.1| COG1018: Flavodoxin reductases (f... 42 0.008
gi|68447624|dbj|BAE05208.1| unnamed protein product [Staphylococ... 42 0.008
gi|78694013|ref|ZP_00858527.1| probable bacterial hemoglobin [Br... 42 0.009
gi|71899704|ref|ZP_00681856.1| Globin:Oxidoreductase FAD/NAD(P)-... 42 0.009
gi|7160162|emb|CAB76347.1| flavohemoprotein [Streptomyces coelic... 41 0.010
gi|23494502|dbj|BAC19468.1| putative flavohemoprotein [Corynebac... 40 0.017
gi|52695858|pdb|1TU9|A Chain A, Crystal Structure Of A Hypotheti... 40 0.025
gi|27377918|ref|NP_769447.1| probable bacterial hemoglobin [Brad... 40 0.025
gi|49076996|gb|AAT49624.1| PA3967 [synthetic construct] 40 0.026
gi|5738846|emb|CAB52917.1| putative flavohemoprotein [Streptomyc... 40 0.028
gi|32039132|ref|ZP_00137404.1| hypothetical protein Paer03001589... 40 0.030
gi|15807907|ref|NP_285566.1| flavohemoprotein [Deinococcus radio... 40 0.031
gi|29830819|ref|NP_825453.1| putative flavohemoprotein [Streptom... 40 0.033
gi|27467358|ref|NP_763995.1| putative flavohemoprotein [Staphylo... 40 0.034
gi|73542903|ref|YP_297423.1| Globin:Oxidoreductase FAD/NAD(P)-bi... 39 0.038
gi|53761559|ref|ZP_00167097.2| COG1018: Flavodoxin reductases (f... 39 0.049
gi|35212137|dbj|BAC89513.1| glr1572 [Gloeobacter violaceus PCC 7... 38 0.063
gi|68053706|ref|ZP_00537871.1| Globin:Oxidoreductase FAD/NAD(P)-... 38 0.063
gi|23129187|ref|ZP_00111020.1| COG1017: Hemoglobin-like flavopro... 38 0.12
gi|68053794|ref|ZP_00537959.1| chemotaxis sensory transducer [Ex... 37 0.15
gi|79039223|ref|ZP_00870929.1| flavohemoprotein [Novosphingobium... 37 0.17
gi|21739948|emb|CAD38995.1| hypothetical protein [Homo sapiens] 37 0.18
gi|78366901|ref|ZP_00837177.1| Globin [Shewanella sp. PV-4] >gnl... 37 0.22
gi|78488035|ref|ZP_00840287.1| globin-like protein [Rhodopseudom... 37 0.23
gi|23006958|ref|ZP_00049038.1| COG1018: Flavodoxin reductases (f... 37 0.25
gi|54025655|ref|YP_119897.1| putative flavohemoprotein [Nocardia... 37 0.25
gi|17934934|ref|NP_531724.1| methyl-accepting chemotaxis protein... 37 0.28
gi|10955046|ref|NP_059702.1| ophE [Agrobacterium tumefaciens] >g... 36 0.32
gi|28195138|gb|AAO33779.1| OphE [Agrobacterium tumefaciens] 36 0.32
gi|30721694|gb|AAP33671.1| hemoglobin [synthetic construct] >gnl... 36 0.34
gi|14030861|gb|AAD13810.3| paraneoplastic neuronal antigen MA1 [... 36 0.37
gi|49259432|pdb|1V07|A Chain A, Crystal Structure Of Thre11val M... 36 0.39
gi|55641029|ref|XP_510052.1| PREDICTED: paraneoplastic antigen M... 36 0.39
gi|39936771|ref|NP_949047.1| possible hemoprotein [Rhodopseudomo... 36 0.45
gi|3293255|gb|AAC39125.1| neural globin [Cerebratulus lacteus] >... 36 0.50
gi|71066001|ref|YP_264728.1| probable transcriptional regulator,... 35 0.56
gi|46561732|gb|AAT01097.1| bacterial hemoglobin [Vitreoscilla st... 35 0.57
gi|50302221|ref|XP_451044.1| unnamed protein product [Kluyveromy... 35 0.69
gi|55229828|gb|AAV45247.1| heme-based aerotactic transducer HemA... 35 0.77
gi|68545124|ref|ZP_00584675.1| Globin [Shewanella amazonensis SB... 35 0.78
gi|66910991|gb|AAH97291.1| Pnma1 protein [Rattus norvegicus] >gn... 35 1.0
gi|11993939|ref|NP_031405.1| ATP-binding cassette, sub-family A ... 35 1.1
gi|73964283|ref|XP_547896.2| PREDICTED: similar to Paraneoplasti... 34 1.1
gi|62512166|sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-famil... 34 1.1
gi|77738771|ref|ZP_00807264.1| Globin [Rhodopseudomonas palustri... 34 1.2
gi|48146341|emb|CAG33393.1| PNMA1 [Homo sapiens] 34 1.3
gi|50843514|ref|YP_056741.1| hypothetical protein PPA2072 [Propi... 34 1.3
gi|52002733|gb|AAU22675.1| haem-based aerotactic transducer [Bac... 34 1.7
gi|67987603|gb|EAM75394.1| regulatory protein, TetR:Tetracyclin ... 34 1.7
gi|1654421|gb|AAB17881.1| transducer HtB protein [Halobacterium ... 34 1.8
gi|15790497|ref|NP_280321.1| Htr10 [Halobacterium sp. NRC-1] >gn... 34 1.8
gi|58037211|ref|NP_081714.1| paraneoplastic antigen MA1 [Mus mus... 34 1.9
gi|79041065|ref|ZP_00872438.1| Histidine kinase, HAMP region:Bac... 33 2.0
gi|74205371|dbj|BAE23177.1| unnamed protein product [Mus musculu... 33 2.0
gi|76628386|ref|XP_582205.2| PREDICTED: similar to Paraneoplasti... 33 2.5
gi|51535360|dbj|BAD37231.1| putative DNA replication licensing f... 33 3.0
gi|23014982|ref|ZP_00054774.1| COG0840: Methyl-accepting chemota... 33 3.3
gi|31791567|ref|NP_854060.1| PROBABLE O-SUCCINYLHOMOSERINE SULFH... 33 3.4
gi|13421593|gb|AAK22415.1| methyl-accepting chemotaxis protein M... 33 3.4
gi|48766282|ref|ZP_00270832.1| COG0840: Methyl-accepting chemota... 33 4.2
gi|61556945|ref|NP_001013119.1| modulator of apoptosis 1 (predic... 32 5.0
gi|76800685|ref|YP_325693.1| transducer protein hemAT [Natronomo... 32 5.2
gi|77463802|ref|YP_353306.1| TlpL, putative cytoplasmic chemorec... 32 5.8
gi|8050848|gb|AAF71774.1| NysA [Streptomyces noursei] 32 5.9
gi|78696500|ref|ZP_00861009.1| globin-like protein [Bradyrhizobi... 32 6.3
gi|70724703|gb|AAZ07866.1| flavohemoglobin [Cryptococcus gattii]... 32 6.9
gi|13470629|ref|NP_102198.1| hypothetical protein mll0395 [Mesor... 32 7.3
gi|33286890|gb|AAH55374.1| MAP-1 protein [Mus musculus] 32 7.9
gi|11612503|ref|NP_071718.1| MAP-1 protein [Mus musculus] >gnl|B... 32 8.1
gi|71839690|ref|ZP_00679434.1| hypothetical protein PproDRAFT_03... 32 8.5
gi|48763697|ref|ZP_00268251.1| COG0840: Methyl-accepting chemota... 31 9.7

Database: nr.blast-2.2.13
Posted date: Dec 7, 2005 6:34 PM
Number of letters in database: 997,100,554
Number of sequences in database: 2,899,401

Database: data/nrdb/nr.blast-2.2.13.01
Posted date: Dec 7, 2005 6:36 PM
Number of letters in database: 50,188,754
Number of sequences in database: 144,822

Lambda K H
0.313 0.178 0.528

Lambda K H
0.267 0.0549 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,657,100,498
Number of Sequences: 3044223
Number of extensions: 86631307
Number of successful extensions: 234093
Number of sequences better than 10.0: 496
Number of HSP's better than 10.0 without gapping: 1134
Number of HSP's successfully gapped in prelim test: 766
Number of HSP's that attempted gapping in prelim test: 231472
Number of HSP's gapped (non-prelim): 1935
length of query: 116
length of database: 1,047,289,308
effective HSP length: 83
effective length of query: 33
effective length of database: 794,618,799
effective search space: 26222420367
effective search space used: 26222420367
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.0 bits)
S2: 71 (31.5 bits)
date
Tue Dec 30 17:14:56 EST 2008
src/skprof/skprof_client domain jobs/job.92/profile.pssm jobs/job.92/kernel.row
date
Tue Dec 30 17:18:39 EST 2008
dv.svm.1
src/svm/results exp/trn.1 models/svm.models domain/kernel.matrix.diagonal kernel.row dv.svm.1
loading test rows..
first row kii:4900
loaded 1 row result(s)
loading model labels..
loaded 119 model labels
loading models..
Loading kernel diagonal..
loading kernel diagonal...
Opening output file..
Caluculating results..
first row, size:5974
first row, kii:4900
dv.svm.2
src/svm/results exp/trn.2 models/svm.models domain/kernel.matrix.diagonal kernel.row dv.svm.2
loading test rows..
first row kii:4900
loaded 1 row result(s)
loading model labels..
loaded 712 model labels
loading models..
Loading kernel diagonal..
loading kernel diagonal...
Opening output file..
Caluculating results..
first row, size:5974
first row, kii:4900
src/blast/blast-2.2.13/bin/blastpgp -d domain/blast.db -b 0 -i input.fasta -R profile.chk > psiblast.txt
src/scripts/blast.row.py domain/domain.lab psiblast.txt psiblast.row
src/psiblast/psiblast-results exp/trn.3 models/psiblast.models psiblast.row dv.psiblast.3 evalue
loading model labels from:exp/trn.3
loaded 1349 labels
loading models...
loaded models
loading rows...
loaded 1 rows
calculating results and writing prediction matrix..
writing to file:dv.psiblast.3
src/scripts/codes.discriminant.vectors.py "svm 1,svm 2,psiblast 3" dv dv.codes
codes definition:svm 1,svm 2,psiblast 3
src_stem:dv
out_fname:dv.codes
files required:['dv.svm.1', 'dv.svm.2', 'dv.psiblast.3']
opening:dv.svm.1
opening:dv.svm.2
opening:dv.psiblast.3
writing to:dv.codes
end
src/scripts/create.codes.predict.matrix.py exp/codes W dv.codes pd.row
src/scripts/predict.matrix.argmax.py pd.row.cols pd.row predict.y
size of prediction vectors:1349
num predictions:1
Codes Query complete

Sequence	slfeqlggqaavqavtaqfyaniqadatvatffngidmpnqtnktaaflcaalggpnawtgrnlkevhanmgvsnaqfttvighlrsaltgagvaaalveqtvavaetvrgdvvtv
Detection	Fold
Method	One-vs-all PSI-BLAST Superfamily detectors
Job ID	OTI=

Results

Generated data